PDB entry 1o5t

View 1o5t on RCSB PDB site
Description: Crystal structure of the aminoacylation catalytic fragment of human tryptophanyl-tRNA synthetase
Deposited on 2003-10-05, released 2004-07-06
The last revision prior to the SCOP 1.69 freeze date was dated 2004-07-06, with a file datestamp of 2004-07-06.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.245
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1o5ta_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1o5tA (A:)
    sakgidydklivrfgsskidkelinrieratgqrphhflrrgiffshrdmnqvldayenk
    kpfylytgrgpsseamhvghlipfiftkwlqdvfnvplviqmtddekylwkdltldqays
    yavenakdiiacgfdinktfifsdldymgmssgfyknvvkiqkhvtfnqvkgifgftdsd
    cigkisfpaiqaapsfsnsfpqifrdrtdiqclipcaidqdpyfrmtrdvaprigypkpa
    llhstffpalqgaqtkmsasdpnssifltdtakqiktkvnkhafsggrdtieehrqfggn
    cdvdvsfmyltffledddkleqirkdytsgamltgelkkalievlqpliaehqarrkevt
    deivkefmtprklsfdfq