PDB entry 1o5q

View 1o5q on RCSB PDB site
Description: Crystal Structure of Pyruvate and Mg2+ bound 2-methylisocitrate lyase (PrpB) from Salmonella typhimurium
Class: lyase
Keywords: PRPB, lyase, methylisocitrate, methylcitrate cycle, Propionate metabolism, Helix swapping
Deposited on 2003-10-04, released 2003-11-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.2
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Probable methylisocitrate lyase
    Species: Salmonella enterica subsp. enterica serovar Typhimurium [TaxId:90371]
    Gene: prpB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1o5qa_
  • Chain 'B':
    Compound: Probable methylisocitrate lyase
    Species: Salmonella enterica subsp. enterica serovar Typhimurium [TaxId:90371]
    Gene: prpB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1o5qb_
  • Chain 'C':
    Compound: Probable methylisocitrate lyase
    Species: Salmonella enterica subsp. enterica serovar Typhimurium [TaxId:90371]
    Gene: prpB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1o5qc_
  • Chain 'D':
    Compound: Probable methylisocitrate lyase
    Species: Salmonella enterica subsp. enterica serovar Typhimurium [TaxId:90371]
    Gene: prpB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1o5qd_
  • Heterogens: MG, PYR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1o5qA (A:)
    masslhspgqafraalakenplqivgainanhallaqragyqaiylsgggvaagslglpd
    lgistlddvltdirritdvcplpllvdadigfgssafnvartvksiakagaaalhiedqv
    gakrcghrpnkaivskeemvdriraavdartdpnfvimartdalavegleaaldraqayv
    dagadmlfpeaitelsmyrrfadvaqvpilanitefgatplfttdelrsahvamalypls
    aframnraaekvytvlrqegtqknvidimqtrnelyesinyyqfeekldalyrnkksleh
    hhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1o5qA (A:)
    spgqafraalakenplqivgainanhallaqragyqaiylsgggvaagslglpdlgistl
    ddvltdirritdvcplpllvdadigfgssafnvartvksiakagaaalhiedqvaivske
    emvdriraavdartdpnfvimartdalavegleaaldraqayvdagadmlfpeaitelsm
    yrrfadvaqvpilanitefgatplfttdelrsahvamalyplsaframnraaekvytvlr
    qegtqknvidimqtrnelyesinyyqfeekl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1o5qB (B:)
    masslhspgqafraalakenplqivgainanhallaqragyqaiylsgggvaagslglpd
    lgistlddvltdirritdvcplpllvdadigfgssafnvartvksiakagaaalhiedqv
    gakrcghrpnkaivskeemvdriraavdartdpnfvimartdalavegleaaldraqayv
    dagadmlfpeaitelsmyrrfadvaqvpilanitefgatplfttdelrsahvamalypls
    aframnraaekvytvlrqegtqknvidimqtrnelyesinyyqfeekldalyrnkksleh
    hhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1o5qB (B:)
    spgqafraalakenplqivgainanhallaqragyqaiylsgggvaagslglpdlgistl
    ddvltdirritdvcplpllvdadigfgssafnvartvksiakagaaalhiedqvaivske
    emvdriraavdartdpnfvimartdalavegleaaldraqayvdagadmlfpeaitelsm
    yrrfadvaqvpilanitefgatplfttdelrsahvamalyplsaframnraaekvytvlr
    qegtqknvidimqtrnelyesinyyqfe
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1o5qC (C:)
    masslhspgqafraalakenplqivgainanhallaqragyqaiylsgggvaagslglpd
    lgistlddvltdirritdvcplpllvdadigfgssafnvartvksiakagaaalhiedqv
    gakrcghrpnkaivskeemvdriraavdartdpnfvimartdalavegleaaldraqayv
    dagadmlfpeaitelsmyrrfadvaqvpilanitefgatplfttdelrsahvamalypls
    aframnraaekvytvlrqegtqknvidimqtrnelyesinyyqfeekldalyrnkksleh
    hhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1o5qC (C:)
    hspgqafraalakenplqivgainanhallaqragyqaiylsgggvaagslglpdlgist
    lddvltdirritdvcplpllvdadigfgssafnvartvksiakagaaalhiedqvaivsk
    eemvdriraavdartdpnfvimartdalavegleaaldraqayvdagadmlfpeaitels
    myrrfadvaqvpilanitefgatplfttdelrsahvamalyplsaframnraaekvytvl
    rqegtqknvidimqtrnelyesinyyqfeekldal
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1o5qD (D:)
    masslhspgqafraalakenplqivgainanhallaqragyqaiylsgggvaagslglpd
    lgistlddvltdirritdvcplpllvdadigfgssafnvartvksiakagaaalhiedqv
    gakrcghrpnkaivskeemvdriraavdartdpnfvimartdalavegleaaldraqayv
    dagadmlfpeaitelsmyrrfadvaqvpilanitefgatplfttdelrsahvamalypls
    aframnraaekvytvlrqegtqknvidimqtrnelyesinyyqfeekldalyrnkksleh
    hhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1o5qD (D:)
    hspgqafraalakenplqivgainanhallaqragyqaiylsgggvaagslglpdlgist
    lddvltdirritdvcplpllvdadigfgssafnvartvksiakagaaalhiedqvaivsk
    eemvdriraavdartdpnfvimartdalavegleaaldraqayvdagadmlfpeaitels
    myrrfadvaqvpilanitefgatplfttdelrsahvamalyplsaframnraaekvytvl
    rqegtqknvidimqtrnelyesinyyqf