PDB entry 1o5o

View 1o5o on RCSB PDB site
Description: Crystal structure of Uracil phosphoribosyltransferase (TM0721) from Thermotoga maritima at 2.30 A resolution
Class: transferase
Keywords: TM0721, URACIL PHOSPHORIBOSYLTRANSFERASE, STRUCTURAL GENOMICS, JCSG, PSI, Protein Structure Initiative, Joint Center for Structural Genomics, TRANSFERASE
Deposited on 2003-10-03, released 2003-10-14
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.17
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: uracil phosphoribosyltransferase
    Species: Thermotoga maritima [TaxId:2336]
    Gene: TM0721
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9WZI0 (12-220)
      • leader sequence (11)
    Domains in SCOPe 2.05: d1o5oa_
  • Chain 'B':
    Compound: uracil phosphoribosyltransferase
    Species: Thermotoga maritima [TaxId:2336]
    Gene: TM0721
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1o5ob_
  • Chain 'C':
    Compound: uracil phosphoribosyltransferase
    Species: Thermotoga maritima [TaxId:2336]
    Gene: TM0721
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9WZI0 (12-220)
      • leader sequence (11)
    Domains in SCOPe 2.05: d1o5oc_
  • Chain 'D':
    Compound: uracil phosphoribosyltransferase
    Species: Thermotoga maritima [TaxId:2336]
    Gene: TM0721
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9WZI0 (12-220)
      • leader sequence (11)
    Domains in SCOPe 2.05: d1o5od_
  • Heterogens: SO4, U5P, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1o5oA (A:)
    mgsdkihhhhhhmknlvvvdhplikhkltimrdkntgpkefrellreitlllayeatrhl
    kceevevetpitktigyrindkdivvvpilraglvmadgilellpnasvghigiyrdpet
    lqaveyyaklpplnddkevflldpmlatgvssikaieilkengakkitlvaliaapegve
    avekkyedvkiyvaalderlndhgyiipglgdagdrlfrtk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1o5oA (A:)
    hmknlvvvdhplikhkltimrdkntgpkefrellreitlllayeatrhlkceevevetpi
    tktigyrindkdivvvpilraglvmadgilellpnasvghigiyrdpetlqaveyyaklp
    plnddkevflldpmlatgvssikaieilkengakkitlvaliaapegveavekkyedvki
    yvaalderlndhgyiipglgdagdrlfrtk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1o5oB (B:)
    mgsdkihhhhhhmknlvvvdhplikhkltimrdkntgpkefrellreitlllayeatrhl
    kceevevetpitktigyrindkdivvvpilraglvmadgilellpnasvghigiyrdpet
    lqaveyyaklpplnddkevflldpmlatgvssikaieilkengakkitlvaliaapegve
    avekkyedvkiyvaalderlndhgyiipglgdagdrlfrtk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1o5oB (B:)
    mknlvvvdhplikhkltimrdkntgpkefrellreitlllayeatrhlkceevevetpit
    ktigyrindkdivvvpilraglvmadgilellpnasvghigiyrdpetlqaveyyaklpp
    lnddkevflldpmlatgvssikaieilkengakkitlvaliaapegveavekkyedvkiy
    vaalderlndhgyiipglgdagdrlfrtk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1o5oC (C:)
    mgsdkihhhhhhmknlvvvdhplikhkltimrdkntgpkefrellreitlllayeatrhl
    kceevevetpitktigyrindkdivvvpilraglvmadgilellpnasvghigiyrdpet
    lqaveyyaklpplnddkevflldpmlatgvssikaieilkengakkitlvaliaapegve
    avekkyedvkiyvaalderlndhgyiipglgdagdrlfrtk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1o5oC (C:)
    hmknlvvvdhplikhkltimrdkntgpkefrellreitlllayeatrhlkceevevetpi
    tktigyrindkdivvvpilraglvmadgilellpnasvghigiyrdpetlqaveyyaklp
    plnddkevflldpmlatgvssikaieilkengakkitlvaliaapegveavekkyedvki
    yvaalderlndhgyiipglgdagdrlfrtk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1o5oD (D:)
    mgsdkihhhhhhmknlvvvdhplikhkltimrdkntgpkefrellreitlllayeatrhl
    kceevevetpitktigyrindkdivvvpilraglvmadgilellpnasvghigiyrdpet
    lqaveyyaklpplnddkevflldpmlatgvssikaieilkengakkitlvaliaapegve
    avekkyedvkiyvaalderlndhgyiipglgdagdrlfrtk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1o5oD (D:)
    hmknlvvvdhplikhkltimrdkntgpkefrellreitlllayeatrhlkceevevetpi
    tktigyrindkdivvvpilraglvmadgilellpnasvghigiyrdpetlqaveyyaklp
    plnddkevflldpmlatgvssikaieilkengakkitlvaliaapegveavekkyedvki
    yvaalderlndhgyiipglgdagdrlfrtk