PDB entry 1o5l

View 1o5l on RCSB PDB site
Description: Crystal structure of Transcriptional regulator (TM1171) from Thermotoga maritima at 2.30 A resolution
Class: transcription
Keywords: TM1171, TRANSCRIPTIONAL REGULATOR, CRP FAMILY, STRUCTURAL GENOMICS, JCSG, PSI, Protein Structure Initiative, Joint Center for Structural Genomics, TRANSCRIPTION
Deposited on 2003-09-23, released 2003-10-07
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.197
AEROSPACI score: -1.63 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: transcriptional regulator, crp family
    Species: Thermotoga maritima [TaxId:2336]
    Gene: TM1171
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1o5la1
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1o5lA (A:)
    mgsdkihhhhhhmdlkkllpcgkvivfrkgeivkhqddpiedvlillegtlktehvseng
    ktleideikpvqiiasgfifsseprfpvnvvagenskilsipkevfldllmkdrelllff
    lkdvsehfrvvseklfflttktlreklmnflvrhmnekreltlpvtleelsrlfgcarpa
    lsrvfqeleregyiekhgrrikvlknpfehdri
    

    Sequence, based on observed residues (ATOM records): (download)
    >1o5lA (A:)
    mdlkkllpcgkvivfrkgeivkhqddpiedvlillegtlktehvsengktleideikpvq
    iiasgfifsseprfpvnvvagenskilsipkevfldllmkdrelllfflkdvsehfrvvs
    eklfflttk