PDB entry 1o5k

View 1o5k on RCSB PDB site
Description: Crystal structure of Dihydrodipicolinate synthase (TM1521) from Thermotoga maritima at 1.80 A resolution
Class: lyase
Keywords: TM1521, DIHYDRODIPICOLINATE SYNTHASE, STRUCTURAL GENOMICS, JCSG, PSI, Protein Structure Initiative, Joint Center for Structural Genomics, LYASE
Deposited on 2003-09-22, released 2003-10-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Dihydrodipicolinate synthase
    Species: Thermotoga maritima [TaxId:2336]
    Gene: TM1521
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9X1K9 (12-305)
      • leader sequence (11)
      • modified residue (172)
    Domains in SCOPe 2.07: d1o5ka1, d1o5ka2
  • Chain 'B':
    Compound: Dihydrodipicolinate synthase
    Species: Thermotoga maritima [TaxId:2336]
    Gene: TM1521
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9X1K9 (12-305)
      • leader sequence (11)
      • modified residue (172)
    Domains in SCOPe 2.07: d1o5kb1, d1o5kb2
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1o5kA (A:)
    mgsdkihhhhhhmfrgvgtaivtpfkngeldlesyerlvryqlengvnalivlgttgesp
    tvnedereklvsrtleivdgkipvivgagtnstektlklvkqaeklgangvlvvtpyynk
    ptqeglyqhykyisertdlgivvynvpgrtgvnvlpetaariaadlknvvgikeanpdid
    qidrtvsltkqarsdfmvwsgnddrtfyllcaggdgvisvvsnvapkqmvelcaeyfsgn
    leksrevhrklrplmkalfvetnpipvkaalnlmgfienelrlplvpasektvellrnvl
    kesgll
    

    Sequence, based on observed residues (ATOM records): (download)
    >1o5kA (A:)
    hmfrgvgtaivtpfkngeldlesyerlvryqlengvnalivlgttgesptvnedereklv
    srtleivdgkipvivgagtnstektlklvkqaeklgangvlvvtpyynkptqeglyqhyk
    yisertdlgivvynvpgrtgvnvlpetaariaadlknvvgikeanpdidqidrtvsltkq
    arsdfmvwsgnddrtfyllcaggdgvisvvsnvapkqmvelcaeyfsgnleksrevhrkl
    rplmkalfvetnpipvkaalnlmgfienelrlplvpasektvellrnvlkesgll
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1o5kB (B:)
    mgsdkihhhhhhmfrgvgtaivtpfkngeldlesyerlvryqlengvnalivlgttgesp
    tvnedereklvsrtleivdgkipvivgagtnstektlklvkqaeklgangvlvvtpyynk
    ptqeglyqhykyisertdlgivvynvpgrtgvnvlpetaariaadlknvvgikeanpdid
    qidrtvsltkqarsdfmvwsgnddrtfyllcaggdgvisvvsnvapkqmvelcaeyfsgn
    leksrevhrklrplmkalfvetnpipvkaalnlmgfienelrlplvpasektvellrnvl
    kesgll
    

    Sequence, based on observed residues (ATOM records): (download)
    >1o5kB (B:)
    hmfrgvgtaivtpfkngeldlesyerlvryqlengvnalivlgttgesptvnedereklv
    srtleivdgkipvivgagtnstektlklvkqaeklgangvlvvtpyynkptqeglyqhyk
    yisertdlgivvynvpgrtgvnvlpetaariaadlknvvgikeanpdidqidrtvsltkq
    arsdfmvwsgnddrtfyllcaggdgvisvvsnvapkqmvelcaeyfsgnleksrevhrkl
    rplmkalfvetnpipvkaalnlmgfienelrlplvpasektvellrnvlkesgll