PDB entry 1o5j

View 1o5j on RCSB PDB site
Description: crystal structure of periplasmic divalent cation tolerance protein (tm1056) from thermotoga maritima at 1.95 a resolution
Deposited on 2003-09-19, released 2003-09-30
The last revision prior to the SCOP 1.69 freeze date was dated 2003-09-30, with a file datestamp of 2003-09-30.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.159
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1o5ja_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1o5jA (A:)
    mgsdkihhhhhhmilvystfpneekaleigrkllekrliacfnafeirsgywwkgeivqd
    kewaaifktteekekelyeelrklhpyetpaiftlkvenvlteymnwlresvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1o5jA (A:)
    hhhmilvystfpneekaleigrkllekrliacfnafeirsgywwkgeivqdkewaaifkt
    teekekelyeelrklhpyetpaiftlkvenvlteymnwlresvl