PDB entry 1o5f

View 1o5f on RCSB PDB site
Description: Dissecting and Designing Inhibitor Selectivity Determinants at the S1 site Using an Artificial Ala190 Protease (Ala190 uPA)
Deposited on 2003-09-09, released 2004-09-21
The last revision prior to the SCOP 1.69 freeze date was dated 2004-09-21, with a file datestamp of 2004-09-21.
Experiment type: XRAY
Resolution: 1.78 Å
R-factor: 0.193
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Domains in SCOP 1.69: d1o5fh_
  • Chain 'L':
    Domains in SCOP 1.69: d1o5fl_

PDB Chain Sequences:

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1o5fH (H:)
    ivggrdtslgrwpwqvslrydgahlcggsllsgdwvltaahcfpernrvlsrwrvfagav
    aqasphglqlgvqavvyhggylpfrdpnseensndialvhlssplplteyiqpvclpaag
    qalvdgkictvtgwgntqyygqqagvlqearvpiisndvcngadfygnqikpkmfcagyp
    eggidacqgdsggpfvcedsisrtprwrlcgivswgtgcalaqkpgvytkvsdfrewifq
    aikthseasgmvtql
    

    Sequence, based on observed residues (ATOM records): (download)
    >1o5fH (H:)
    ivggrdtslgrwpwqvslrydgahlcggsllsgdwvltaahcfpernrvlsrwrvfagav
    aqasphglqlgvqavvyhggylpfnsndialvhlssplplteyiqpvclpaagqalvdgk
    ictvtgwgntqyygqqagvlqearvpiisndvcngadfygnqikpkmfcagypeggidac
    qgdsggpfvcedsisrtprwrlcgivswgtgcalaqkpgvytkvsdfrewifqaikthse
    asgmvtql
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1o5fL (L:)
    sdqeplypvqvssadarlmvfdktegtwrllcssrsnarvaglsceemgflralthseld
    vrtagaagtsgffcvdegrlphtqrllevisvcdcprgrflaaicqdcgrrklp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1o5fL (L:)
    plypvqvssadarlmvfdktegtwrllcssrsnarvaglsceemgflralthseldvrta
    gaagtsgffcvdegrlphtqrllevisvcdcprgrflaaicqdcgrrklp