PDB entry 1o5e

View 1o5e on RCSB PDB site
Description: Dissecting and Designing Inhibitor Selectivity Determinants at the S1 site Using an Artificial Ala190 Protease (Ala190 uPA)
Class: serine protease, hydrolase
Keywords: srcr, scavenger receptor cysteine-rich domain, serine protease Ala190 uPA, S1 site, selectivity, conserved water displacement hydrogen bond deficit, trypsin, thrombin, hepsin, factor VIIa, serine protease, hydrolase
Deposited on 2003-09-09, released 2004-09-21
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.198
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: Serine protease hepsin
    Species: Homo sapiens [TaxId:9606]
    Gene: HPN OR TMPRSS1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1o5eh_
  • Chain 'L':
    Compound: Serine protease hepsin
    Species: Homo sapiens [TaxId:9606]
    Gene: HPN OR TMPRSS1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05981 (Start-113)
      • engineered (66)
    Domains in SCOPe 2.05: d1o5el_
  • Heterogens: 132, HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1o5eH (H:)
    ivggrdtslgrwpwqvslrydgahlcggsllsgdwvltaahcfpernrvlsrwrvfagav
    aqasphglqlgvqavvyhggylpfrdpnseensndialvhlssplplteyiqpvclpaag
    qalvdgkictvtgwgntqyygqqagvlqearvpiisndvcngadfygnqikpkmfcagyp
    eggidacqgdsggpfvcedsisrtprwrlcgivswgtgcalaqkpgvytkvsdfrewifq
    aikthseasgmvtql
    

    Sequence, based on observed residues (ATOM records): (download)
    >1o5eH (H:)
    ivggrdtslgrwpwqvslrydgahlcggsllsgdwvltaahcfpernrvlsrwrvfagav
    aqasphglqlgvqavvyhggylpfnsndialvhlssplplteyiqpvclpaagqalvdgk
    ictvtgwgntqyygqqagvlqearvpiisndvcngadfygnqikpkmfcagypeggidac
    qgdsggpfvcedsisrtprwrlcgivswgtgcalaqkpgvytkvsdfrewifqaikthse
    asgmvtql
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1o5eL (L:)
    sdqeplypvqvssadarlmvfdktegtwrllcssrsnarvaglsceemgflralthseld
    vrtagaagtsgffcvdegrlphtqrllevisvcdcprgrflaaicqdcgrrklp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1o5eL (L:)
    plypvqvssadarlmvfdktegtwrllcssrsnarvaglsceemgflralthseldvrta
    gaagtsgffcvdegrlphtqrllevisvcdcprgrflaaicqdcgrrklp