PDB entry 1o5e

View 1o5e on RCSB PDB site
Description: dissecting and designing inhibitor selectivity determinants at the s1 site using an artificial ala190 protease (ala190 upa)
Deposited on 2003-09-09, released 2004-09-21
The last revision prior to the SCOP 1.69 freeze date was dated 2004-09-21, with a file datestamp of 2004-09-21.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.198
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Domains in SCOP 1.69: d1o5eh_
  • Chain 'L':
    Domains in SCOP 1.69: d1o5el_

PDB Chain Sequences:

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1o5eH (H:)
    ivggrdtslgrwpwqvslrydgahlcggsllsgdwvltaahcfpernrvlsrwrvfagav
    aqasphglqlgvqavvyhggylpfrdpnseensndialvhlssplplteyiqpvclpaag
    qalvdgkictvtgwgntqyygqqagvlqearvpiisndvcngadfygnqikpkmfcagyp
    eggidacqgdsggpfvcedsisrtprwrlcgivswgtgcalaqkpgvytkvsdfrewifq
    aikthseasgmvtql
    

    Sequence, based on observed residues (ATOM records): (download)
    >1o5eH (H:)
    ivggrdtslgrwpwqvslrydgahlcggsllsgdwvltaahcfpernrvlsrwrvfagav
    aqasphglqlgvqavvyhggylpfnsndialvhlssplplteyiqpvclpaagqalvdgk
    ictvtgwgntqyygqqagvlqearvpiisndvcngadfygnqikpkmfcagypeggidac
    qgdsggpfvcedsisrtprwrlcgivswgtgcalaqkpgvytkvsdfrewifqaikthse
    asgmvtql
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1o5eL (L:)
    sdqeplypvqvssadarlmvfdktegtwrllcssrsnarvaglsceemgflralthseld
    vrtagaagtsgffcvdegrlphtqrllevisvcdcprgrflaaicqdcgrrklp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1o5eL (L:)
    plypvqvssadarlmvfdktegtwrllcssrsnarvaglsceemgflralthseldvrta
    gaagtsgffcvdegrlphtqrllevisvcdcprgrflaaicqdcgrrklp