PDB entry 1o5a

View 1o5a on RCSB PDB site
Description: Dissecting and Designing Inhibitor Selectivity Determinants at the S1 site Using an Artificial Ala190 Protease (Ala190 uPA)
Class: BLOOD CLOTTING, hydrolase
Keywords: Ala190 uPA, S1 site, selectivity, conserved water displacement hydrogen bond deficit, trypsin, thrombin, hepsin, factor VIIa, BLOOD CLOTTING, hydrolase
Deposited on 2003-09-09, released 2004-09-21
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.68 Å
R-factor: 0.209
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: urokinase-type plasminogen activator
    Species: Homo sapiens [TaxId:9606]
    Gene: PLAU
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1o5a.1
  • Chain 'B':
    Compound: urokinase-type plasminogen activator
    Species: Homo sapiens [TaxId:9606]
    Gene: PLAU
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00749 (0-End)
      • engineered (143)
      • engineered (192)
    Domains in SCOPe 2.08: d1o5a.1
  • Heterogens: 696, CIT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1o5aA (A:)
    kpssppeelkfqcgqktlrprfk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1o5aA (A:)
    lkfqcgqkt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1o5aB (B:)
    iiggefttienqpwfaaiyrrhrggsvtyvcggslmspcwvisathcfidypkkedyivy
    lgrsrlnsntqgemkfevenlilhkdysadtlahhndiallkirskegrcaqpsrtiqti
    clpsmyndpqfgtsceitgfgkeastdylypeqlkmtvvklishrecqqphyygsevttk
    mlcaadpqwktdacqgdsggplvcslqgrmtltgivswgrgcalkdkpgvytrvshflpw
    irshtkeenglal
    

    Sequence, based on observed residues (ATOM records): (download)
    >1o5aB (B:)
    iiggefttienqpwfaaiyrrhrggsvtyvcggslmspcwvisathcfidypkkedyivy
    lgrsrlnsntqgemkfevenlilhkdysadtlahhndiallkirskegrcaqpsrtiqti
    clpsmyndpqfgtsceitgfgkeastdylypeqlkmtvvklishrecqqphyygsevttk
    mlcaadpqwktdacqgdsggplvcslqgrmtltgivswgrgcalkdkpgvytrvshflpw
    irshtk