PDB entry 1o59

View 1o59 on RCSB PDB site
Description: crystal structure of allantoicase (yir029w) from saccharomyces cerevisiae at 2.40 a resolution
Deposited on 2003-08-22, released 2003-09-02
The last revision prior to the SCOP 1.67 freeze date was dated 2003-09-02, with a file datestamp of 2003-09-02.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.178
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1o59A (A:)
    mgsdkihhhhhhmkffsladeaefksiiisknkavdvigsklggqvvsfsdewfasaenl
    iqptapirdptrfvhsgawydgwetrrhnemeydwviikmgvaaahiiggeidtaffngn
    hapfvsiealydegeegniveddsrwveivekfecgpsqrhlfvrgngltkerfthiklk
    mypdggiarfrlygrvvppelktkdhiidlayvcngavalkysdqhfgsvdnlllpgrgh
    dmsdgwetkrsrqpghtdwaviqlgressfiekiivdtahfrgnfpqfitvegclkeses
    sentgegtwvelvgksktgpdkehvyeirksirvshvkltiipdggvkrirvwgy
    

    Sequence, based on observed residues (ATOM records): (download)
    >1o59A (A:)
    hmkffsladeaefksiiisknkavdvigsklggqvvsfsdewfasaenliqptapirdwy
    dgwetrrhnemeydwviikmgvaaahiiggeidtaffngnhapfvsiealydegeegniv
    eddsrwveivekfecgpsqrhlfvrgngltkerfthiklkmypdggiarfrlygrvvpph
    iidlayvcngavalkysdqhfgsvdnlllpgrghdmsdgwetkrsrqpghtdwaviqlgr
    essfiekiivdtahfrgnfpqfitvegclktwvelvgksktgpdkehvyeirksirvshv
    kltiipdggvkrirvwgy