PDB entry 1o57

View 1o57 on RCSB PDB site
Description: crystal structure of the purine operon repressor of bacillus subtilis
Deposited on 2003-04-20, released 2003-08-26
The last revision prior to the SCOP 1.69 freeze date was dated 2003-09-09, with a file datestamp of 2003-09-09.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.188
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1o57A (A:)
    mkfrrsgrlvdltnyllthphelipltffseryesakssisedltiikqtfeqqgigtll
    tvpgaaggvkyipkmkqaeaeefvqtlgqslanperilpggyvyltdilgkpsvlskvgk
    lfasvfaereidvvmtvatkgiplayaaasylnvpvvivrkdnkvtegstvsinyvsgss
    nriqtmslakrsmktgsnvliiddfmkaggtingminlldefnanvagigvlveaegvde
    rlvdeymslltlstinmkeksieiqngnflrffkdnllkngeteshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1o57A (A:)
    kfrrsgrlvdltnyllthphelipltffseryesakssisedltiikqtfeqqgigtllt
    vpgaaggvkyipkmkqaeaeefvqtlgqslanperilpggyvyltdilgkpsvlskvgkl
    fasvfaereidvvmtvatkgiplayaaasylnvpvvivrkdgstvsinyvsgssnriqtm
    slakrsmktgsnvliiddfmkaggtingminlldefnanvagigvlveaegvderlvdey
    mslltlstinmkeksieiqngnflrffkdn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1o57B (B:)
    mkfrrsgrlvdltnyllthphelipltffseryesakssisedltiikqtfeqqgigtll
    tvpgaaggvkyipkmkqaeaeefvqtlgqslanperilpggyvyltdilgkpsvlskvgk
    lfasvfaereidvvmtvatkgiplayaaasylnvpvvivrkdnkvtegstvsinyvsgss
    nriqtmslakrsmktgsnvliiddfmkaggtingminlldefnanvagigvlveaegvde
    rlvdeymslltlstinmkeksieiqngnflrffkdnllkngeteshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1o57B (B:)
    mkfrrsgrlvdltnyllthphelipltffseryesakssisedltiikqtfeqqgigtll
    tvpgaaggvkyipkmkqaeaeefvqtlgqslanperilpggyvyltdilgkpsvlskvgk
    lfasvfaereidvvmtvatkgiplayaaasylnvpvvivrkdgstvsinyvsgssnriqt
    mslakrsmktgsnvliiddfmkaggtingminlldefnanvagigvlveaegvderlvde
    ymslltlstinmkeksieiqngnflrffk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1o57C (C:)
    mkfrrsgrlvdltnyllthphelipltffseryesakssisedltiikqtfeqqgigtll
    tvpgaaggvkyipkmkqaeaeefvqtlgqslanperilpggyvyltdilgkpsvlskvgk
    lfasvfaereidvvmtvatkgiplayaaasylnvpvvivrkdnkvtegstvsinyvsgss
    nriqtmslakrsmktgsnvliiddfmkaggtingminlldefnanvagigvlveaegvde
    rlvdeymslltlstinmkeksieiqngnflrffkdnllkngeteshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1o57C (C:)
    mkfrrsgrlvdltnyllthphelipltffseryesakssisedltiikqtfeqqgigtll
    tvpgaaggvkyipkmkqaeaeefvqtlgqslanperilpggyvyltdilgkpsvlskvgk
    lfasvfaereidvvmtvatkgiplayaaasylnvpvvivrkdgstvsinyvsgssnriqt
    mslakrsmktgsnvliiddfmkaggtingminlldefnanvagigvlveaegvderlvde
    ymslltlstinmkeksieiqngnflrffk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1o57D (D:)
    mkfrrsgrlvdltnyllthphelipltffseryesakssisedltiikqtfeqqgigtll
    tvpgaaggvkyipkmkqaeaeefvqtlgqslanperilpggyvyltdilgkpsvlskvgk
    lfasvfaereidvvmtvatkgiplayaaasylnvpvvivrkdnkvtegstvsinyvsgss
    nriqtmslakrsmktgsnvliiddfmkaggtingminlldefnanvagigvlveaegvde
    rlvdeymslltlstinmkeksieiqngnflrffkdnllkngeteshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1o57D (D:)
    kfrrsgrlvdltnyllthphelipltffseryesakssisedltiikqtfeqqgigtllt
    vpgaaggvkyipkmkqaeaeefvqtlgqslanperilpggyvyltdilgkpsvlskvgkl
    fasvfaereidvvmtvatkgiplayaaasylnvpvvivrkdgstvsinyvsgssnriqtm
    slakrsmktgsnvliiddfmkaggtingminlldefnanvagigvlveaegvderlvdey
    mslltlstinmkeksieiqngnflrffkdn