PDB entry 1o50

View 1o50 on RCSB PDB site
Description: crystal structure of a cbs domain-containing protein (tm0935) from thermotoga maritima at 1.87 a resolution
Deposited on 2003-07-31, released 2003-08-12
The last revision prior to the SCOP 1.67 freeze date was dated 2003-08-12, with a file datestamp of 2003-08-12.
Experiment type: XRAY
Resolution: 1.87 Å
R-factor: 0.194
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1o50A (A:)
    mgsdkihhhhhhmkvkdvcklislkptvveedtpieeivdriledpvtrtvyvardnklv
    gmipvmhllkvsgfhffgfipkeelirssmkrliaknaseimldpvyvhmdtpleealkl
    midnniqempvvdekgeivgdlnsleillalwkgrek
    

    Sequence, based on observed residues (ATOM records): (download)
    >1o50A (A:)
    hhhmkvkdvcklislkptvveedtpieeivdriledpvtrtvyvardnklvgmipvmhll
    kvsgfhffgfipsmkrliaknaseimldpvyvhmdtpleealklmidnniqempvvdekg
    eivgdlnsleillalwkgrek