PDB entry 1o50

View 1o50 on RCSB PDB site
Description: Crystal structure of a cbs domain-containing protein (tm0935) from thermotoga maritima at 1.87 A resolution
Class: transferase
Keywords: Cbs-domain pair fold, structural genomics, Joint Center for Structural Genomics, JCSG, Protein Structure Initiative, PSI, transferase
Deposited on 2003-07-31, released 2003-08-12
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-07-18, with a file datestamp of 2018-07-13.
Experiment type: XRAY
Resolution: 1.87 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: CBS domain-containing predicted protein TM0935
    Species: Thermotoga maritima [TaxId:2336]
    Gene: TM0935
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9X033 (12-156)
      • leader sequence (9-11)
    Domains in SCOPe 2.08: d1o50a3, d1o50a4
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1o50A (A:)
    mgsdkihhhhhhmkvkdvcklislkptvveedtpieeivdriledpvtrtvyvardnklv
    gmipvmhllkvsgfhffgfipkeelirssmkrliaknaseimldpvyvhmdtpleealkl
    midnniqempvvdekgeivgdlnsleillalwkgrek
    

    Sequence, based on observed residues (ATOM records): (download)
    >1o50A (A:)
    hhhmkvkdvcklislkptvveedtpieeivdriledpvtrtvyvardnklvgmipvmhll
    kvsgfhffgfipsmkrliaknaseimldpvyvhmdtpleealklmidnniqempvvdekg
    eivgdlnsleillalwkgrek