PDB entry 1o4z

View 1o4z on RCSB PDB site
Description: the three-dimensional structure of beta-agarase b from zobellia galactanivorans
Deposited on 2003-07-29, released 2003-12-09
The last revision prior to the SCOP 1.67 freeze date was dated 2003-12-09, with a file datestamp of 2003-12-09.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.169
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1o4za_
  • Chain 'B':
    Domains in SCOP 1.67: d1o4zb_
  • Chain 'C':
    Domains in SCOP 1.67: d1o4zc_
  • Chain 'D':
    Domains in SCOP 1.67: d1o4zd_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1o4zA (A:)
    mdigdnskfdsatdlpveqeqeqeteqegepeesseqdlveevdwkdipvpadagpnmkw
    efqeisdnfeyeapadnkgseflekwddfyhnawagpgltewkrdrsyvadgelkmwatr
    kpgsdkinmgcitsktrvvypvyiearakvmnstlasdvwllsaddtqeidileaygady
    sesagkdhsyfskkvhishhvfirdpfqdyqpkdagswfedgtvwnkefhrfgvywrdpw
    hleyyidgvlvrtvsgkdiidpkhftnttdpgnteidtrtglnkemdiiintedqtwrss
    pasglqsntytptdnelsnienntfgvdwiriykpveklehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1o4zA (A:)
    dwkdipvpadagpnmkwefqeisdnfeyeapadnkgseflekwddfyhnawagpgltewk
    rdrsyvadgelkmwatrkpgsdkinmgcitsktrvvypvyiearakvmnstlasdvwlls
    addtqeidileaygadysesagkdhsyfskkvhishhvfirdpfqdyqpkdagswfedgt
    vwnkefhrfgvywrdpwhleyyidgvlvrtvsgkdiidpkhftnttdpgnteidtrtgln
    kemdiiintedqtwrsspasglqsntytptdnelsnienntfgvdwiriykpvek
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1o4zB (B:)
    mdigdnskfdsatdlpveqeqeqeteqegepeesseqdlveevdwkdipvpadagpnmkw
    efqeisdnfeyeapadnkgseflekwddfyhnawagpgltewkrdrsyvadgelkmwatr
    kpgsdkinmgcitsktrvvypvyiearakvmnstlasdvwllsaddtqeidileaygady
    sesagkdhsyfskkvhishhvfirdpfqdyqpkdagswfedgtvwnkefhrfgvywrdpw
    hleyyidgvlvrtvsgkdiidpkhftnttdpgnteidtrtglnkemdiiintedqtwrss
    pasglqsntytptdnelsnienntfgvdwiriykpveklehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1o4zB (B:)
    vdwkdipvpadagpnmkwefqeisdnfeyeapadnkgseflekwddfyhnawagpgltew
    krdrsyvadgelkmwatrkpgsdkinmgcitsktrvvypvyiearakvmnstlasdvwll
    saddtqeidileaygadysesagkdhsyfskkvhishhvfirdpfqdyqpkdagswfedg
    tvwnkefhrfgvywrdpwhleyyidgvlvrtvsgkdiidpkhftnttdpgnteidtrtgl
    nkemdiiintedqtwrsspasglqsntytptdnelsnienntfgvdwiriykpvekl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1o4zC (C:)
    mdigdnskfdsatdlpveqeqeqeteqegepeesseqdlveevdwkdipvpadagpnmkw
    efqeisdnfeyeapadnkgseflekwddfyhnawagpgltewkrdrsyvadgelkmwatr
    kpgsdkinmgcitsktrvvypvyiearakvmnstlasdvwllsaddtqeidileaygady
    sesagkdhsyfskkvhishhvfirdpfqdyqpkdagswfedgtvwnkefhrfgvywrdpw
    hleyyidgvlvrtvsgkdiidpkhftnttdpgnteidtrtglnkemdiiintedqtwrss
    pasglqsntytptdnelsnienntfgvdwiriykpveklehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1o4zC (C:)
    vdwkdipvpadagpnmkwefqeisdnfeyeapadnkgseflekwddfyhnawagpgltew
    krdrsyvadgelkmwatrkpgsdkinmgcitsktrvvypvyiearakvmnstlasdvwll
    saddtqeidileaygadysesagkdhsyfskkvhishhvfirdpfqdyqpkdagswfedg
    tvwnkefhrfgvywrdpwhleyyidgvlvrtvsgkdiidpkhftnttdpgnteidtrtgl
    nkemdiiintedqtwrsspasglqsntytptdnelsnienntfgvdwiriykpvek
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1o4zD (D:)
    mdigdnskfdsatdlpveqeqeqeteqegepeesseqdlveevdwkdipvpadagpnmkw
    efqeisdnfeyeapadnkgseflekwddfyhnawagpgltewkrdrsyvadgelkmwatr
    kpgsdkinmgcitsktrvvypvyiearakvmnstlasdvwllsaddtqeidileaygady
    sesagkdhsyfskkvhishhvfirdpfqdyqpkdagswfedgtvwnkefhrfgvywrdpw
    hleyyidgvlvrtvsgkdiidpkhftnttdpgnteidtrtglnkemdiiintedqtwrss
    pasglqsntytptdnelsnienntfgvdwiriykpveklehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1o4zD (D:)
    vdwkdipvpadagpnmkwefqeisdnfeyeapadnkgseflekwddfyhnawagpgltew
    krdrsyvadgelkmwatrkpgsdkinmgcitsktrvvypvyiearakvmnstlasdvwll
    saddtqeidileaygadysesagkdhsyfskkvhishhvfirdpfqdyqpkdagswfedg
    tvwnkefhrfgvywrdpwhleyyidgvlvrtvsgkdiidpkhftnttdpgnteidtrtgl
    nkemdiiintedqtwrsspasglqsntytptdnelsnienntfgvdwiriykpvekl