PDB entry 1o4y

View 1o4y on RCSB PDB site
Description: the three-dimensional structure of beta-agarase a from zobellia galactanivorans
Class: hydrolase
Keywords: beta-agarase, glycoside hydrolase family 16, agarose degradation, cleavage of beta-1, 4-d-galactose linkages
Deposited on 2003-07-29, released 2003-12-09
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.48 Å
R-factor: 0.149
AEROSPACI score: 0.68 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: beta-agarase A
    Species: Zobellia galactanivorans [TaxId:63186]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9RGX9 (3-End)
      • see remark 999 (67)
    Domains in SCOPe 2.06: d1o4ya_
  • Heterogens: NA, CA, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1o4yA (A:)
    mdiaqdwngipvpanpgngmtwqlqdnvsdsfnytssegnrptaftskwkpsyingwtgp
    gstifnapqawtngsqlaiqaqpagngksyngiitsknkiqypvymeikakimdqvlana
    fwtltddetqeidimegygsdrggtwfaqrmhlshhtfirnpftdyqpmgdatwyynggt
    pwrsayhrygcywkdpftleyyidgvkvrtvtraeidpnnhlggtglnqatniiidcenq
    tdwrpaatqeeladdsknifwvdwirvykpvavsgggnnslehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1o4yA (A:)
    aqdwngipvpanpgngmtwqlqdnvsdsfnytssegnrptaftskwkpsyingwtgpgst
    ifnapqawtngsqlaiqaqpagngksyngiitsknkiqypvymeikakimdqvlanafwt
    ltddetqeidimegygsdrggtwfaqrmhlshhtfirnpftdyqpmgdatwyynggtpwr
    sayhrygcywkdpftleyyidgvkvrtvtraeidpnnhlggtglnqatniiidcenqtdw
    rpaatqeeladdsknifwvdwirvykpvav