PDB entry 1o4o

View 1o4o on RCSB PDB site
Description: crystal structure of sh2 in complex with phenylphosphate.
Deposited on 2003-06-15, released 2004-02-17
The last revision prior to the SCOP 1.67 freeze date was dated 2004-02-17, with a file datestamp of 2004-02-17.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.202
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1o4oa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1o4oA (A:)
    siqaeewyfgkitrreserlllnaenprgtflvresettkgayclsvsdfdnakglnvkh
    ykirkldsggfyitsrtqfnslqqlvayyskhadglchrlttvcptsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1o4oA (A:)
    siqaeewyfgkitrreserlllnaenprgtflvresettkgayclsvsdfdnakglnvkh
    ykirkldsggfyitsrtqfnslqqlvayyskhadglchrlttvcpt