PDB entry 1o4f

View 1o4f on RCSB PDB site
Description: crystal structure of sh2 in complex with ru79073.
Class: signaling protein
Keywords: sh2 domain fragment approach, signaling protein
Deposited on 2003-06-15, released 2004-02-17
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.164
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Proto-oncogene tyrosine-protein kinase Src
    Species: Homo sapiens [TaxId:9606]
    Gene: SRC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P12931 (0-End)
      • modified residue (43)
    Domains in SCOPe 2.08: d1o4fa_
  • Heterogens: 790, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1o4fA (A:)
siqaeewyfgkitrreserlllnaenprgtflvresettkgayclsvsdfdnakglnvkh
ykirkldsggfyitsrtqfnslqqlvayyskhadglchrlttvcptsk

    Sequence, based on observed residues (ATOM records): (download) 
    >1o4fA (A:)
siqaeewyfgkitrreserlllnaenprgtflvresettkgayclsvsdfdnakglnvkh
ykirkldsggfyitsrtqfnslqqlvayyskhadglchrlttvcp