PDB entry 1o3y

View 1o3y on RCSB PDB site
Description: Crystal structure of mouse ARF1 (delta17-Q71L), GTP form
Class: protein transport
Keywords: protein transport
Deposited on 2003-05-08, released 2003-05-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.191
AEROSPACI score: 0.62 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ADP-ribosylation factor 1
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P84078 (2-165)
      • cloning artifact (0-1)
      • engineered (55)
    Domains in SCOPe 2.07: d1o3ya1, d1o3ya2
  • Chain 'B':
    Compound: ADP-ribosylation factor 1
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P84078 (2-165)
      • cloning artifact (0-1)
      • engineered (55)
    Domains in SCOPe 2.07: d1o3yb1, d1o3yb2
  • Heterogens: MG, GTP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1o3yA (A:)
gsmrilmvgldaagkttilyklklgeivttiptigfnvetveyknisftvwdvggldkir
plwrhyfqntqglifvvdsndrervneareelmrmlaedelrdavllvfankqdlpnamn
aaeitdklglhslrhrnwyiqatcatsgdglyegldwlsnqlrnqk

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1o3yB (B:)
gsmrilmvgldaagkttilyklklgeivttiptigfnvetveyknisftvwdvggldkir
plwrhyfqntqglifvvdsndrervneareelmrmlaedelrdavllvfankqdlpnamn
aaeitdklglhslrhrnwyiqatcatsgdglyegldwlsnqlrnqk