PDB entry 1o3w

View 1o3w on RCSB PDB site
Description: Structure of the inhibitor free triple mutant (K53,56,120M) of phospholipase A2
Class: hydrolase
Keywords: Alpha Helix, Beta Sheet, Triple mutant, Calcium ion, HYDROLASE
Deposited on 2003-04-14, released 2003-07-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.193
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phospholipase a2
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00593 (0-122)
      • engineered (52)
      • engineered (55)
      • engineered (119)
    Domains in SCOPe 2.07: d1o3wa_
  • Heterogens: CA, MPD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1o3wA (A:)
    alwqfngmikckipsseplldfnnygcycglggsgtpvddldrccqthdncymqamklds
    ckvlvdnpytnnysyscsnneitcssennaceaficncdrnaaicfskvpynkehknldm
    knc