PDB entry 1o3d

View 1o3d on RCSB PDB site
Description: elaborate manifold of short hydrogen bond arrays mediating binding of active site-directed serine protease inhibitors
Deposited on 2003-03-06, released 2003-09-02
The last revision prior to the SCOP 1.69 freeze date was dated 2003-09-02, with a file datestamp of 2003-09-02.
Experiment type: XRAY
Resolution: 1.33 Å
R-factor: 0.194
AEROSPACI score: 0.7 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1o3da_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1o3dA (A:)
    ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
    neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
    wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
    vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn