PDB entry 1o2f

View 1o2f on RCSB PDB site
Description: complex of enzyme iiaglc and iibglc phosphocarrier protein hpr from escherichia coli nmr, restrained regularized mean structure
Class: transferase
Keywords: phosphotransferase, transferase, kinase, sugar transport, complex (transferase-phosphocarrier)
Deposited on 2003-03-11, released 2003-05-13
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-06-30, with a file datestamp of 2021-06-25.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pts system, glucose-specific iia component
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1o2fa_
  • Chain 'B':
    Compound: PTS system, glucose-specific IIBC component
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P69786 (Start-89)
      • see remark 999 (16)
    Domains in SCOPe 2.08: d1o2fb_
  • Heterogens: PO3

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1o2fA (A:)
    glfdklkslvsddkkdtgtieiiaplsgeivniedvpdvvfaekivgdgiaikptgnkmv
    apvdgtigkifetnhafsiesdsgvelfvhfgidtvelkgegfkriaeegqrvkvgdtvi
    efdlplleekakstltpvvisnmdeikeliklsgsvtvgetpvirikk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1o2fA (A:)
    tieiiaplsgeivniedvpdvvfaekivgdgiaikptgnkmvapvdgtigkifetnhafs
    iesdsgvelfvhfgidtvelkgegfkriaeegqrvkvgdtviefdlplleekakstltpv
    visnmdeikeliklsgsvtvgetpvirikk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1o2fB (B:)
    edatedakatgtsemaaalvaafggkenitnldacitrlrvsvadvskvdqaglkklgaa
    gvvvagsgvqaifgtksdnlktemdeyirn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1o2fB (B:)
    emaaalvaafggkenitnldacitrlrvsvadvskvdqaglkklgaagvvvagsgvqaif
    gtksdnlktemdeyirn