PDB entry 1o2e

View 1o2e on RCSB PDB site
Description: Structure of the triple mutant (K53,56,120M) + Anisic acid complex of phospholipase A2
Class: hydrolase
Keywords: Alpha Helix, Beta Sheet, Triple mutant, Anisic acid, HYDROLASE
Deposited on 2003-03-05, released 2003-09-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: phospholipase a2
  Species: Bos taurus [TaxId:9913]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00593 (0-122)
    • engineered (52)
    • engineered (55)
    • engineered (119)
  Domains in SCOPe 2.07: d1o2ea_
• Heterogens: CA, ANN, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1o2eA (A:)
  alwqfngmikckipsseplldfnnygcycglggsgtpvddldrccqthdncymqamklds
  ckvlvdnpytnnysyscsnneitcssennaceaficncdrnaaicfskvpynkehknldm
  knc