PDB entry 1o23

View 1o23 on RCSB PDB site
Description: crystal structure of lactose synthase in the presence of udp-glucose
Class: transferase activator/transferase
Keywords: alpha-lactalbumin; beta,1,4-galactosyltransferase; udp-glucose, transferase activator-transferase complex
Deposited on 2003-01-29, released 2003-02-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-05-08, with a file datestamp of 2013-05-03.
Experiment type: XRAY
Resolution: 2.32 Å
R-factor: 0.201
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: alpha-lactalbumin
    Species: Mus musculus [TaxId:10090]
    Gene: Lalba
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1o23a_
  • Chain 'B':
    Compound: beta-1,4-galactosyltransferase
    Species: Bos taurus [TaxId:9913]
    Gene: beta1,4-galactosyltransferase
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1o23b_
  • Chain 'C':
    Compound: alpha-lactalbumin
    Species: Mus musculus [TaxId:10090]
    Gene: Lalba
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1o23c_
  • Chain 'D':
    Compound: beta-1,4-galactosyltransferase
    Species: Bos taurus [TaxId:9913]
    Gene: beta1,4-galactosyltransferase
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1o23d_
  • Heterogens: CA, MN, UPG, UDP, PG4, MES, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1o23A (A:)
    teltkckvshaikdidgyqgisllewacvlfhtsgydtqavvndngsteyglfqisdrfw
    ckssefpesenicgiscdkllddeldddiacakkilaikgidywkaykpmcsekleqwrc
    ekp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1o23B (B:)
    asmtggqqmgrgssltacpeespllvgpmliefnipvdlklveqqnpkvklggrytpmdc
    isphkvaiiipfrnrqehlkywlyylhpilqrqqldygiyvinqagesmfnrakllnvgf
    kealkdydyncfvfsdvdlipmndhntyrcfsqprhisvamdkfgfslpyvqyfggvsal
    skqqflsingfpnnywgwggedddiynrlafrgmsvsrpnavigkcrmirhsrdkknepn
    pqrfdriahtketmlsdglnsltymvlevqryplytkitvdigtps
    

    Sequence, based on observed residues (ATOM records): (download)
    >1o23B (B:)
    ltacpeespllvgpmliefnipvdlklveqqnpkvklggrytpmdcisphkvaiiipfrn
    rqehlkywlyylhpilqrqqldygiyvinqagesmfnrakllnvgfkealkdydyncfvf
    sdvdlipmndhntyrcfsqprhisvamdkfgfslpyvqyfggvsalskqqflsingfpnn
    ywgwggedddiynrlafrgmsvsrpnavigkcrmirhsrdkknepnpqrfdriahtketm
    lsdglnsltymvlevqryplytkitvdigtps
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1o23C (C:)
    teltkckvshaikdidgyqgisllewacvlfhtsgydtqavvndngsteyglfqisdrfw
    ckssefpesenicgiscdkllddeldddiacakkilaikgidywkaykpmcsekleqwrc
    ekp
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1o23D (D:)
    asmtggqqmgrgssltacpeespllvgpmliefnipvdlklveqqnpkvklggrytpmdc
    isphkvaiiipfrnrqehlkywlyylhpilqrqqldygiyvinqagesmfnrakllnvgf
    kealkdydyncfvfsdvdlipmndhntyrcfsqprhisvamdkfgfslpyvqyfggvsal
    skqqflsingfpnnywgwggedddiynrlafrgmsvsrpnavigkcrmirhsrdkknepn
    pqrfdriahtketmlsdglnsltymvlevqryplytkitvdigtps
    

    Sequence, based on observed residues (ATOM records): (download)
    >1o23D (D:)
    ltacpeespllvgpmliefnipvdlklveqqnpkvklggrytpmdcisphkvaiiipfrn
    rqehlkywlyylhpilqrqqldygiyvinqagesmfnrakllnvgfkealkdydyncfvf
    sdvdlipmndhntyrcfsqprhisvamdkfgfslpyvqyfggvsalskqqflsingfpnn
    ywgwggedddiynrlafrgmsvsrpnavigkcrmirhsrdkknepnpqrfdriahtketm
    lsdglnsltymvlevqryplytkitvdigtps