PDB entry 1o1t

View 1o1t on RCSB PDB site
Description: Structure of FPT bound to the CVIM-FPP product
Class: transferase
Keywords: Transferase, prenyltransferase
Deposited on 2003-01-14, released 2003-05-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein farnesyltransferase alpha subunit
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Fnta
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q04631
      • conflict (158)
    Domains in SCOPe 2.07: d1o1ta_
  • Chain 'B':
    Compound: Protein farnesyltransferase beta subunit
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Fntb
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1o1tb_
  • Heterogens: MG, ZN, 2NH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1o1tA (A:)
    gshmaategvgesapggepgqpeqpppppppppaqqpqeeemaaeageaaaspmddgfls
    ldsptyvlyrdraewadidpvpqndgpspvvqiiysekfrdvydyfravlqrderseraf
    kltrdaielnaanytvwhfrrvllrslqkdlqeemnyitaiieeqpknyqvwhhrrvlve
    wlkdpsqelefiadilnqdaknyhawqhrqwviqefrlwdnelqyvdqllkedvrnnsvw
    nqrhfvisnttgysdravlerevqytlemiklvphnesawnylkgilqdrglsrypnlln
    qlldlqpshsspyliaflvdiyedmlenqcdnkedilnkalelceilakekdtirkeywr
    yigrslqskhsresdipasv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1o1tA (A:)
    gflsldsptyvlyrdraewadidpvpqndgpspvvqiiysekfrdvydyfravlqrders
    erafkltrdaielnaanytvwhfrrvllrslqkdlqeemnyitaiieeqpknyqvwhhrr
    vlvewlkdpsqelefiadilnqdaknyhawqhrqwviqefrlwdnelqyvdqllkedvrn
    nsvwnqrhfvisnttgysdravlerevqytlemiklvphnesawnylkgilqdrglsryp
    nllnqlldlqpshsspyliaflvdiyedmlenqcdnkedilnkalelceilakekdtirk
    eywryigrslqskhs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1o1tB (B:)
    massssftyycppssspvwseplyslrpeharerlqddsvetvtsieqakveekiqevfs
    sykfnhlvprlvlqrekhfhylkrglrqltdayecldasrpwlcywilhslelldepipq
    ivatdvcqflelcqspdggfgggpgqyphlaptyaavnalciigteeaynvinrekllqy
    lyslkqpdgsflmhvggevdvrsaycaasvasltniitpdlfegtaewiarcqnweggig
    gvpgmeahggytfcglaalvilkkerslnlksllqwvtsrqmrfeggfqgrcnklvdgcy
    sfwqagllpllhralhaqgdpalsmshwmfhqqalqeyilmccqcpagglldkpgksrdf
    yhtcyclsglsiaqhfgsgamlhdvvmgvpenvlqpthpvynigpdkviqatthflqkpv
    pgfeece
    

    Sequence, based on observed residues (ATOM records): (download)
    >1o1tB (B:)
    lyslrpeharerlqddsvetvtsieqakveekiqevfssykfnhlvprlvlqrekhfhyl
    krglrqltdayecldasrpwlcywilhslelldepipqivatdvcqflelcqspdggfgg
    gpgqyphlaptyaavnalciigteeaynvinrekllqylyslkqpdgsflmhvggevdvr
    saycaasvasltniitpdlfegtaewiarcqnweggiggvpgmeahggytfcglaalvil
    kkerslnlksllqwvtsrqmrfeggfqgrcnklvdgcysfwqagllpllhralhaqgdpa
    lsmshwmfhqqalqeyilmccqcpagglldkpgksrdfyhtcyclsglsiaqhfgsgaml
    hdvvmgvpenvlqpthpvynigpdkviqatthflqkpvpgf