PDB entry 1o1r

View 1o1r on RCSB PDB site
Description: structure of fpt bound to ggpp
Deposited on 2003-01-14, released 2003-05-06
The last revision prior to the SCOP 1.65 freeze date was dated 2003-05-06, with a file datestamp of 2003-05-06.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.177
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.65: d1o1ra_
  • Chain 'B':
    Domains in SCOP 1.65: d1o1rb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1o1rA (A:)
    gshmaategvgesapggepgqpeqpppppppppaqqpqeeemaaeageaaaspmddgfls
    ldsptyvlyrdraewadidpvpqndgpspvvqiiysekfrdvydyfravlqrderseraf
    kltrdaielnaanytvwhfrrvllrslqkdlqeemnyitaiieeqpknyqvwhhrrvlve
    wlkdpsqelefiadilnqdaknyhawqhrqwviqefrlwdnelqyvdqllkedvrnnsvw
    nqrhfvisnttgysdravlerevqytlemiklvphnesawnylkgilqdrglsrypnlln
    qlldlqpshsspyliaflvdiyedmlenqcdnkedilnkalelceilakekdtirkeywr
    yigrslqskhsresdipasv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1o1rA (A:)
    gflsldsptyvlyrdraewadidpvpqndgpspvvqiiysekfrdvydyfravlqrders
    erafkltrdaielnaanytvwhfrrvllrslqkdlqeemnyitaiieeqpknyqvwhhrr
    vlvewlkdpsqelefiadilnqdaknyhawqhrqwviqefrlwdnelqyvdqllkedvrn
    nsvwnqrhfvisnttgysdravlerevqytlemiklvphnesawnylkgilqdrglsryp
    nllnqlldlqpshsspyliaflvdiyedmlenqcdnkedilnkalelceilakekdtirk
    eywryigrslqskhs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1o1rB (B:)
    massssftyycppssspvwseplyslrpeharerlqddsvetvtsieqakveekiqevfs
    sykfnhlvprlvlqrekhfhylkrglrqltdayecldasrpwlcywilhslelldepipq
    ivatdvcqflelcqspdggfgggpgqyphlaptyaavnalciigteeaynvinrekllqy
    lyslkqpdgsflmhvggevdvrsaycaasvasltniitpdlfegtaewiarcqnweggig
    gvpgmeahggytfcglaalvilkkerslnlksllqwvtsrqmrfeggfqgrcnklvdgcy
    sfwqagllpllhralhaqgdpalsmshwmfhqqalqeyilmccqcpagglldkpgksrdf
    yhtcyclsglsiaqhfgsgamlhdvvmgvpenvlqpthpvynigpdkviqatthflqkpv
    pgfeece
    

    Sequence, based on observed residues (ATOM records): (download)
    >1o1rB (B:)
    lyslrpeharerlqddsvetvtsieqakveekiqevfssykfnhlvprlvlqrekhfhyl
    krglrqltdayecldasrpwlcywilhslelldepipqivatdvcqflelcqspdggfgg
    gpgqyphlaptyaavnalciigteeaynvinrekllqylyslkqpdgsflmhvggevdvr
    saycaasvasltniitpdlfegtaewiarcqnweggiggvpgmeahggytfcglaalvil
    kkerslnlksllqwvtsrqmrfeggfqgrcnklvdgcysfwqagllpllhralhaqgdpa
    lsmshwmfhqqalqeyilmccqcpagglldkpgksrdfyhtcyclsglsiaqhfgsgaml
    hdvvmgvpenvlqpthpvynigpdkviqatthflqkpvpgf