PDB entry 1o1o

View 1o1o on RCSB PDB site
Description: Deoxy hemoglobin (A,C:V1M,V62L; B,D:V1M,V67L)
Class: oxygen storage/transport
Keywords: heme, oxygen delivery vehicle, blood substitute, oxygen storage/transport complex
Deposited on 2002-11-17, released 2002-12-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.181
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hemoglobin alpha chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P69905 (0-140)
      • engineered (0)
      • engineered (61)
    Domains in SCOPe 2.07: d1o1oa_
  • Chain 'B':
    Compound: hemoglobin beta chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P68871 (0-145)
      • engineered (0)
      • engineered (66)
    Domains in SCOPe 2.07: d1o1ob_
  • Chain 'C':
    Compound: hemoglobin alpha chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P69905 (0-140)
      • engineered (0)
      • engineered (61)
    Domains in SCOPe 2.07: d1o1oc_
  • Chain 'D':
    Compound: hemoglobin beta chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P68871 (0-145)
      • engineered (0)
      • engineered (66)
    Domains in SCOPe 2.07: d1o1od_
  • Heterogens: HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1o1oA (A:)
    mlspadktnvkaawgkvgahageygaealermflsfpttktyfphfdlshgsaqvkghgk
    kladaltnavahvddmpnalsalsdlhahklrvdpvnfkllshcllvtlaahlpaeftpa
    vhasldkflasvstvltskyr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1o1oB (B:)
    mhltpeeksavtalwgkvnvdevggealgrllvvypwtqrffesfgdlstpdavmgnpkv
    kahgkkllgafsdglahldnlkgtfatlselhcdklhvdpenfrllgnvlvcvlahhfgk
    eftppvqaayqkvvagvanalahkyh
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1o1oC (C:)
    mlspadktnvkaawgkvgahageygaealermflsfpttktyfphfdlshgsaqvkghgk
    kladaltnavahvddmpnalsalsdlhahklrvdpvnfkllshcllvtlaahlpaeftpa
    vhasldkflasvstvltskyr
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1o1oD (D:)
    mhltpeeksavtalwgkvnvdevggealgrllvvypwtqrffesfgdlstpdavmgnpkv
    kahgkkllgafsdglahldnlkgtfatlselhcdklhvdpenfrllgnvlvcvlahhfgk
    eftppvqaayqkvvagvanalahkyh