PDB entry 1o1m

View 1o1m on RCSB PDB site
Description: deoxy hemoglobin (a-glyglygly-c:v1m,l29f,h58q b,d:v1m,v67w)
Deposited on 2002-11-17, released 2002-12-18
The last revision prior to the SCOP 1.63 freeze date was dated 2002-12-18, with a file datestamp of 2002-12-18.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.2
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1o1mA (A:)
    mlspadktnvkaawgkvgahageygaeafermflsfpttktyfphfdlshgsaqvkgqgk
    kvadaltnavahvddmpnalsalsdlhahklrvdpvnfkllshcllvtlaahlpaeftpa
    vhasldkflasvstvltskyrgggvlspadktnvkaawgkvgahageygaeafermflsf
    pttktyfphfdlshgsaqvkgqgkkvadaltnavahvddmpnalsalsdlhahklrvdpv
    nfkllshcllvtlaahlpaeftpavhasldkflasvstvltskyr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1o1mA (A:)
    mlspadktnvkaawgkvgahageygaeafermflsfpttktyfphfdlshgsaqvkgqgk
    kvadaltnavahvddmpnalsalsdlhahklrvdpvnfkllshcllvtlaahlpaeftpa
    vhasldkflasvstvltskyrvlspadktnvkaawgkvgahageygaeafermflsfptt
    ktyfphfdlshgsaqvkgqgkkvadaltnavahvddmpnalsalsdlhahklrvdpvnfk
    llshcllvtlaahlpaeftpavhasldkflasvstvltskyr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1o1mB (B:)
    mhltpeeksavtalwgkvnvdevggealgrllvvypwtqrffesfgdlstpdavmgnpkv
    kahgkkwlgafsdglahldnlkgtfatlselhcdklhvdpenfrllgnvlvcvlahhfgk
    eftppvqaayqkvvagvanalahkyh
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1o1mD (D:)
    mhltpeeksavtalwgkvnvdevggealgrllvvypwtqrffesfgdlstpdavmgnpkv
    kahgkkwlgafsdglahldnlkgtfatlselhcdklhvdpenfrllgnvlvcvlahhfgk
    eftppvqaayqkvvagvanalahkyh