PDB entry 1o17

View 1o17 on RCSB PDB site
Description: anthranilate phosphoribosyl-transferase (trpd)
Class: transferase
Keywords: nucleoside-phosphorylases, TRANSFERASE
Deposited on 2002-10-29, released 2002-11-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-11-16, with a file datestamp of 2011-11-11.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.213
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Anthranilate phosphoribosyltransferase
    Species: Sulfolobus solfataricus [TaxId:2287]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1o17a1, d1o17a2
  • Chain 'B':
    Compound: Anthranilate phosphoribosyltransferase
    Species: Sulfolobus solfataricus [TaxId:2287]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1o17b1, d1o17b2
  • Chain 'C':
    Compound: Anthranilate phosphoribosyltransferase
    Species: Sulfolobus solfataricus [TaxId:2287]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1o17c1, d1o17c2
  • Chain 'D':
    Compound: Anthranilate phosphoribosyltransferase
    Species: Sulfolobus solfataricus [TaxId:2287]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1o17d1, d1o17d2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1o17A (A:)
    mnineilkklinksdleineaeelakaiirgevpeilvsailvalrmkgeskneivgfar
    amrelaikidvpnaidtagtggdglgtvnvstasaillslvnpvakhgnravsgksgsad
    vlealgyniivpperakelvnktnfvflfaqyyhpamknvanvrktlgirtifnilgplt
    npanakyqlmgvfskdhldllsksayeldfnkiilvygepgidevspigntfmkivskrg
    ieevklnvtdfgispipieklivnsaedsaikivraflgkdehvaefikintavalfald
    rvgdfregyeyadhlieksldklneiismngdvtklktivvkssg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1o17A (A:)
    mnineilkklinksdleineaeelakaiirgevpeilvsailvalrmkgeskneivgfar
    amrelaikidvpnaidtagglgtvnvstasaillslvnpvakhgnravsgksgsadvlea
    lgyniivpperakelvnktnfvflfaqyyhpamknvanvrktlgirtifnilgpltnpan
    akyqlmgvfskdhldllsksayeldfnkiilvygepgidevspigntfmkivskrgieev
    klnvtdfgispipieklivnsaedsaikivraflgkdehvaefikintavalfaldrvgd
    fregyeyadhlieksldklneiismngdvtklktivvks
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1o17B (B:)
    mnineilkklinksdleineaeelakaiirgevpeilvsailvalrmkgeskneivgfar
    amrelaikidvpnaidtagtggdglgtvnvstasaillslvnpvakhgnravsgksgsad
    vlealgyniivpperakelvnktnfvflfaqyyhpamknvanvrktlgirtifnilgplt
    npanakyqlmgvfskdhldllsksayeldfnkiilvygepgidevspigntfmkivskrg
    ieevklnvtdfgispipieklivnsaedsaikivraflgkdehvaefikintavalfald
    rvgdfregyeyadhlieksldklneiismngdvtklktivvkssg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1o17B (B:)
    mnineilkklinksdleineaeelakaiirgevpeilvsailvalrmkgeskneivgfar
    amrelaikidvpnaidtagdglgtvnvstasaillslvnpvakhgnravsgksgsadvle
    algyniivpperakelvnktnfvflfaqyyhpamknvanvrktlgirtifnilgpltnpa
    nakyqlmgvfskdhldllsksayeldfnkiilvygepgidevspigntfmkivskrgiee
    vklnvtdfgispipieklivnsaedsaikivraflgkdehvaefikintavalfaldrvg
    dfregyeyadhlieksldklneiismngdvtklktivvks
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1o17C (C:)
    mnineilkklinksdleineaeelakaiirgevpeilvsailvalrmkgeskneivgfar
    amrelaikidvpnaidtagtggdglgtvnvstasaillslvnpvakhgnravsgksgsad
    vlealgyniivpperakelvnktnfvflfaqyyhpamknvanvrktlgirtifnilgplt
    npanakyqlmgvfskdhldllsksayeldfnkiilvygepgidevspigntfmkivskrg
    ieevklnvtdfgispipieklivnsaedsaikivraflgkdehvaefikintavalfald
    rvgdfregyeyadhlieksldklneiismngdvtklktivvkssg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1o17C (C:)
    mnineilkklinksdleineaeelakaiirgevpeilvsailvalrmkgeskneivgfar
    amrelaikidvpnaidtagglgtvnvstasaillslvnpvakhgnravsgksgsadvlea
    lgyniivpperakelvnktnfvflfaqyyhpamknvanvrktlgirtifnilgpltnpan
    akyqlmgvfskdhldllsksayeldfnkiilvygepgidevspigntfmkivskrgieev
    klnvtdfgispipieklivnsaedsaikivraflgkdehvaefikintavalfaldrvgd
    fregyeyadhlieksldklneiismngdvtklktivvkssg
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1o17D (D:)
    mnineilkklinksdleineaeelakaiirgevpeilvsailvalrmkgeskneivgfar
    amrelaikidvpnaidtagtggdglgtvnvstasaillslvnpvakhgnravsgksgsad
    vlealgyniivpperakelvnktnfvflfaqyyhpamknvanvrktlgirtifnilgplt
    npanakyqlmgvfskdhldllsksayeldfnkiilvygepgidevspigntfmkivskrg
    ieevklnvtdfgispipieklivnsaedsaikivraflgkdehvaefikintavalfald
    rvgdfregyeyadhlieksldklneiismngdvtklktivvkssg