PDB entry 1o17

View 1o17 on RCSB PDB site
Description: anthranilate phosphoribosyl-transferase (trpd)
Deposited on 2002-10-29, released 2002-11-01
The last revision prior to the SCOP 1.65 freeze date was dated 2002-11-01, with a file datestamp of 2002-11-01.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.213
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1o17A (A:)
    mnineilkklinksdleineaeelakaiirgevpeilvsailvalrmkgeskneivgfar
    amrelaikidvpnaidtagtggdglgtvnvstasaillslvnpvakhgnravsgksgsad
    vlealgyniivpperakelvnktnfvflfaqyyhpamknvanvrktlgirtifnilgplt
    npanakyqlmgvfskdhldllsksayeldfnkiilvygepgidevspigntfmkivskrg
    ieevklnvtdfgispipieklivnsaedsaikivraflgkdehvaefikintavalfald
    rvgdfregyeyadhlieksldklneiismngdvtklktivvkssg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1o17A (A:)
    mnineilkklinksdleineaeelakaiirgevpeilvsailvalrmkgeskneivgfar
    amrelaikidvpnaidtagglgtvnvstasaillslvnpvakhgnravsgksgsadvlea
    lgyniivpperakelvnktnfvflfaqyyhpamknvanvrktlgirtifnilgpltnpan
    akyqlmgvfskdhldllsksayeldfnkiilvygepgidevspigntfmkivskrgieev
    klnvtdfgispipieklivnsaedsaikivraflgkdehvaefikintavalfaldrvgd
    fregyeyadhlieksldklneiismngdvtklktivvks
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1o17B (B:)
    mnineilkklinksdleineaeelakaiirgevpeilvsailvalrmkgeskneivgfar
    amrelaikidvpnaidtagtggdglgtvnvstasaillslvnpvakhgnravsgksgsad
    vlealgyniivpperakelvnktnfvflfaqyyhpamknvanvrktlgirtifnilgplt
    npanakyqlmgvfskdhldllsksayeldfnkiilvygepgidevspigntfmkivskrg
    ieevklnvtdfgispipieklivnsaedsaikivraflgkdehvaefikintavalfald
    rvgdfregyeyadhlieksldklneiismngdvtklktivvkssg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1o17B (B:)
    mnineilkklinksdleineaeelakaiirgevpeilvsailvalrmkgeskneivgfar
    amrelaikidvpnaidtagdglgtvnvstasaillslvnpvakhgnravsgksgsadvle
    algyniivpperakelvnktnfvflfaqyyhpamknvanvrktlgirtifnilgpltnpa
    nakyqlmgvfskdhldllsksayeldfnkiilvygepgidevspigntfmkivskrgiee
    vklnvtdfgispipieklivnsaedsaikivraflgkdehvaefikintavalfaldrvg
    dfregyeyadhlieksldklneiismngdvtklktivvks
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1o17C (C:)
    mnineilkklinksdleineaeelakaiirgevpeilvsailvalrmkgeskneivgfar
    amrelaikidvpnaidtagtggdglgtvnvstasaillslvnpvakhgnravsgksgsad
    vlealgyniivpperakelvnktnfvflfaqyyhpamknvanvrktlgirtifnilgplt
    npanakyqlmgvfskdhldllsksayeldfnkiilvygepgidevspigntfmkivskrg
    ieevklnvtdfgispipieklivnsaedsaikivraflgkdehvaefikintavalfald
    rvgdfregyeyadhlieksldklneiismngdvtklktivvkssg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1o17C (C:)
    mnineilkklinksdleineaeelakaiirgevpeilvsailvalrmkgeskneivgfar
    amrelaikidvpnaidtagglgtvnvstasaillslvnpvakhgnravsgksgsadvlea
    lgyniivpperakelvnktnfvflfaqyyhpamknvanvrktlgirtifnilgpltnpan
    akyqlmgvfskdhldllsksayeldfnkiilvygepgidevspigntfmkivskrgieev
    klnvtdfgispipieklivnsaedsaikivraflgkdehvaefikintavalfaldrvgd
    fregyeyadhlieksldklneiismngdvtklktivvkssg
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1o17D (D:)
    mnineilkklinksdleineaeelakaiirgevpeilvsailvalrmkgeskneivgfar
    amrelaikidvpnaidtagtggdglgtvnvstasaillslvnpvakhgnravsgksgsad
    vlealgyniivpperakelvnktnfvflfaqyyhpamknvanvrktlgirtifnilgplt
    npanakyqlmgvfskdhldllsksayeldfnkiilvygepgidevspigntfmkivskrg
    ieevklnvtdfgispipieklivnsaedsaikivraflgkdehvaefikintavalfald
    rvgdfregyeyadhlieksldklneiismngdvtklktivvkssg