PDB entry 1o16

View 1o16 on RCSB PDB site
Description: recombinant sperm whale myoglobin h64d/v68s/d122n mutant (met)
Class: oxygen storage/transport
Keywords: myoglobin, enzyme, sulfoxidation, oxygen storage/transport complex
Deposited on 2002-10-25, released 2003-11-04
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.16
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Myoglobin
    Species: Physeter catodon [TaxId:9755]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02185 (1-153)
      • initiating methionine (0)
      • engineered (64)
      • engineered (68)
      • engineered (122)
    Domains in SCOPe 2.05: d1o16a_
  • Heterogens: SO4, HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1o16A (A:)
    mvlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkase
    dlkkdgvtsltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrh
    pgnfgadaqgamnkalelfrkdiaakykelgyqg