PDB entry 1o14

View 1o14 on RCSB PDB site
Description: Crystal structure of possible 1-phosphofructokinase (TM0828) from Thermotoga maritima at 3.2 A resolution
Deposited on 2002-10-15, released 2002-11-27
The last revision prior to the SCOP 1.69 freeze date was dated 2004-08-10, with a file datestamp of 2004-08-10.
Experiment type: XRAY
Resolution: 3.2 Å
R-factor: 0.236
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1o14a_
  • Chain 'B':
    Domains in SCOP 1.69: d1o14b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1o14A (A:)
    mgsdkihhhhhhmvltvtlnpaldreifiedfqvnrlyrindlsktqmspggkginvsia
    lsklgvpsvatgfvggymgkilveelrkisklittnfvyvegetrenieiideknktita
    infpgpdvtdmdvnhflrrykmtlskvdcvvisgsippgvnegicnelvrlarergvfvf
    veqtprlleriyegpefpnvvkpdlrgnhasflgvdlktfddyvklaeklaeksqvsvvs
    yevkndivatregvwlirskeeidtshllgagdayvagmvyyfikhganflemakfgfas
    alaatrrkekympdleaikkeydhftvervk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1o14A (A:)
    mvltvtlnpaldreifiedfqvnrlyrindlsktqmspggkginvsialsklgvpsvatg
    fvggymgkilveelrkisklittnfvyvegetrenieiideknktitainfpgpdvtdmd
    vnhflrrykmtlskvdcvvisgsippgvnegicnelvrlarergvfvfveqtprlleriy
    egpefpnvvkpdlrgnhasflgvdlktfddyvklaeklaeksqvsvvsyevkndivatre
    gvwlirskeeidtshllgagdayvagmvyyfikhganflemakfgfasalaatrrkekym
    pdleaikkeydhftvervk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1o14B (B:)
    mgsdkihhhhhhmvltvtlnpaldreifiedfqvnrlyrindlsktqmspggkginvsia
    lsklgvpsvatgfvggymgkilveelrkisklittnfvyvegetrenieiideknktita
    infpgpdvtdmdvnhflrrykmtlskvdcvvisgsippgvnegicnelvrlarergvfvf
    veqtprlleriyegpefpnvvkpdlrgnhasflgvdlktfddyvklaeklaeksqvsvvs
    yevkndivatregvwlirskeeidtshllgagdayvagmvyyfikhganflemakfgfas
    alaatrrkekympdleaikkeydhftvervk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1o14B (B:)
    mvltvtlnpaldreifiedfqvnrlyrindlsktqmspggkginvsialsklgvpsvatg
    fvggymgkilveelrkisklittnfvyvegetrenieiideknktitainfpgpdvtdmd
    vnhflrrykmtlskvdcvvisgsippgvnegicnelvrlarergvfvfveqtprlleriy
    egpefpnvvkpdlrgnhasflgvdlktfddyvklaeklaeksqvsvvsyevkndivatre
    gvwlirskeeidtshllgagdayvagmvyyfikhganflemakfgfasalaatrrkekym
    pdleaikkeydhftvervk