PDB entry 1o13

View 1o13 on RCSB PDB site
Description: Crystal structure of a putative dinitrogenase iron-molybdenum cofactor (tm1816) from thermotoga maritima at 1.83 A resolution
Class: biosynthetic protein
Keywords: Ribonuclease h-like motif fold, structural genomics, Joint Center for Structural Genomics, JCSG, Protein Structure Initiative, PSI, biosynthetic protein
Deposited on 2002-10-15, released 2002-12-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 1.83 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: probable NifB protein
  Species: Thermotoga maritima [TaxId:2336]
  Gene: TM1816
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9X2D6 (12-End)
    • modified residue (12)
    • modified residue (95)
  Domains in SCOPe 2.07: d1o13a_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >1o13A (A:)
  mgsdkihhhhhhmiiaipvsenrgkdspisehfgrapyfafvkvknnaiadisveenpla
  qdhvhgavpnfvkekgaelvivrgigrraiaafeamgvkvikgasgtveevvnqylsgql
  kdsdyevhdhhhhehh
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >1o13A (A:)
  miiaipvsenrgkdspisehfgrapyfafvkvknnaiadisveenplaqdhvhgavpnfv
  kekgaelvivrgigrraiaafeamgvkvikgasgtveevvnqylsgq