PDB entry 1o0y

View 1o0y on RCSB PDB site
Description: Crystal structure of Deoxyribose-phosphate aldolase (TM1559) from Thermotoga maritima at 1.9 A resolution
Class: lyase
Keywords: TM1559, Deoxyribose-phosphate aldolase, STRUCTURAL GENOMICS, JCSG, PSI, Protein Structure Initiative, Joint Center for Structural Genomics, LYASE
Deposited on 2002-09-13, released 2002-12-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-05-18, with a file datestamp of 2011-05-13.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.179
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: deoxyribose-phosphate aldolase
    Species: Thermotoga maritima [TaxId:2336]
    Gene: TM1559
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9X1P5 (12-End)
      • expression tag (8-11)
    Domains in SCOPe 2.07: d1o0ya1, d1o0ya2
  • Chain 'B':
    Compound: deoxyribose-phosphate aldolase
    Species: Thermotoga maritima [TaxId:2336]
    Gene: TM1559
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9X1P5 (12-End)
      • expression tag (8-11)
    Domains in SCOPe 2.07: d1o0yb1, d1o0yb2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1o0yA (A:)
    mgsdkihhhhhhmieyrieeavakyrefyefkpvresagiedvksaiehtnlkpfatpdd
    ikklclearenrfhgvcvnpcyvklareelegtdvkvvtvvgfplganetrtkaheaifa
    vesgadeidmvinvgmlkakeweyvyedirsvvesvkgkvvkviietcyldteekiaacv
    isklagahfvktstgfgtggataedvhlmkwivgdemgvkasggirtfedavkmimygad
    rigtssgvkivqggeerygg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1o0yA (A:)
    hhhhmieyrieeavakyrefyefkpvresagiedvksaiehtnlkpfatpddikklclea
    renrfhgvcvnpcyvklareelegtdvkvvtvvgfplganetrtkaheaifavesgadei
    dmvinvgmlkakeweyvyedirsvvesvkgkvvkviietcyldteekiaacvisklagah
    fvktstgfgtggataedvhlmkwivgdemgvkasggirtfedavkmimygadrigtssgv
    kivqggeeryg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1o0yB (B:)
    mgsdkihhhhhhmieyrieeavakyrefyefkpvresagiedvksaiehtnlkpfatpdd
    ikklclearenrfhgvcvnpcyvklareelegtdvkvvtvvgfplganetrtkaheaifa
    vesgadeidmvinvgmlkakeweyvyedirsvvesvkgkvvkviietcyldteekiaacv
    isklagahfvktstgfgtggataedvhlmkwivgdemgvkasggirtfedavkmimygad
    rigtssgvkivqggeerygg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1o0yB (B:)
    hhhhmieyrieeavakyrefyefkpvresagiedvksaiehtnlkpfatpddikklclea
    renrfhgvcvnpcyvklareelegtdvkvvtvvgfplganetrtkaheaifavesgadei
    dmvinvgmlkakeweyvyedirsvvesvkgkvvkviietcyldteekiaacvisklagah
    fvktstgfgtggataedvhlmkwivgdemgvkasggirtfedavkmimygadrigtssgv
    kivqggeeryg