PDB entry 1o0w

View 1o0w on RCSB PDB site
Description: Crystal structure of Ribonuclease III (TM1102) from Thermotoga maritima at 2.0 A resolution
Class: hydrolase
Keywords: TM1102, Ribonuclease III, STRUCTURAL GENOMICS, JCSG, PSI, Protein Structure Initiative, Joint Center for Structural Genomics, HYDROLASE
Deposited on 2002-09-13, released 2002-11-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ribonuclease III
    Species: Thermotoga maritima [TaxId:2336]
    Gene: TM1102
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9X0I6 (12-End)
      • expression tag (10-11)
    Domains in SCOPe 2.07: d1o0wa1, d1o0wa2, d1o0wa3
  • Chain 'B':
    Compound: Ribonuclease III
    Species: Thermotoga maritima [TaxId:2336]
    Gene: TM1102
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9X0I6 (12-End)
      • expression tag (10-11)
    Domains in SCOPe 2.07: d1o0wb1, d1o0wb2, d1o0wb3
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1o0wA (A:)
    mgsdkihhhhhhmneserkiveefqketginfkneellfralchssyaneqnqagrkdve
    snekleflgdavlelfvceilykkypeaevgdlarvksaaaseevlamvsrkmnlgkflf
    lgkgeektggrdrdsiladafeallaaiyldqgyekikelfeqefefyiekimkgemlfd
    yktalqeivqsehkvppeyilvrtekndgdrifvvevrvngktiatgkgrtkkeaekeaa
    riayekllkers
    

    Sequence, based on observed residues (ATOM records): (download)
    >1o0wA (A:)
    hhmneserkiveefqketginfkneellfralchssyaneqnqagrkdvesnekleflgd
    avlelfvceilykkypeaevgdlarvksaaaseevlamvsrkmnlgkflflgkgeektgg
    rdrdsiladafeallaaiyldqgyekikelfeqefefyiekimkgemlfdyktalqeivq
    sehkvppeyilvrtekndgdrifvvevrvngktiatgkgrtkkeaekeaariayekll
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1o0wB (B:)
    mgsdkihhhhhhmneserkiveefqketginfkneellfralchssyaneqnqagrkdve
    snekleflgdavlelfvceilykkypeaevgdlarvksaaaseevlamvsrkmnlgkflf
    lgkgeektggrdrdsiladafeallaaiyldqgyekikelfeqefefyiekimkgemlfd
    yktalqeivqsehkvppeyilvrtekndgdrifvvevrvngktiatgkgrtkkeaekeaa
    riayekllkers
    

    Sequence, based on observed residues (ATOM records): (download)
    >1o0wB (B:)
    hhmneserkiveefqketginfkneellfralchssyaneqnqagrkdvesnekleflgd
    avlelfvceilykkypeaevgdlarvksaaaseevlamvsrkmnlgkflflgkgeektgg
    rdrdsiladafeallaaiyldqgyekikelfeqefefyiekimkgemlfdyktalqeivq
    sehkvppeyilvrtekndgdrifvvevrvngktiatgkgrtkkeaekeaariayekllk