PDB entry 1o0p

View 1o0p on RCSB PDB site
Description: solution structure of the third rna recognition motif (rrm) of u2af65 in complex with an n-terminal sf1 peptide
Deposited on 2003-02-24, released 2003-05-06
The last revision prior to the SCOP 1.69 freeze date was dated 2003-05-06, with a file datestamp of 2003-05-06.
Experiment type: NMR10
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.69: d1o0pa_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1o0pA (A:)
  ghptevlclmnmvlpeellddeeyeeivedvrdecskyglvksieiprpvdgvevpgcgk
  ifveftsvfdcqkamqgltgrkfanrvvvtkycdpdsyhrrdfw