PDB entry 1o0p

View 1o0p on RCSB PDB site
Description: Solution Structure of the third RNA Recognition Motif (RRM) of U2AF65 in complex with an N-terminal SF1 peptide
Deposited on 2003-02-24, released 2003-05-06
The last revision prior to the SCOP 1.65 freeze date was dated 2003-05-06, with a file datestamp of 2003-05-06.
Experiment type: NMR10
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.65: d1o0pa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1o0pA (A:)
    ghptevlclmnmvlpeellddeeyeeivedvrdecskyglvksieiprpvdgvevpgcgk
    ifveftsvfdcqkamqgltgrkfanrvvvtkycdpdsyhrrdfw