PDB entry 1o0l

View 1o0l on RCSB PDB site
Description: the structure of bcl-w reveals a role for the c-terminal residues in modulating biological activity
Class: apoptosis
Keywords: apoptosis, bcl-2, helical bundle, binding groove, bh3
Deposited on 2003-02-22, released 2003-04-01
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Apoptosis regulator Bcl-W
    Species: Homo sapiens [TaxId:9606]
    Gene: BCL2L2 OR BCLW OR KIAA0271
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q92843 (5-187)
      • cloning artifact (0-4)
      • engineered (132)
    Domains in SCOPe 2.05: d1o0la_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1o0lA (A:)
    gplgsmatpasapdtralvadfvgyklrqkgyvcgagpgegpaadplhqamraagdefet
    rfrrtfsdlaaqlhvtpgsaqqrftqvsdelfqggpnwgrlvaffvfgaalcaesvnkem
    eplvgqvqewmveyletrladwihssggwaeftalygdgaleearrlregnwasvrtvlt
    gavalgal