PDB entry 1o0e

View 1o0e on RCSB PDB site
Description: 1.9 Angstrom Crystal Structure of a plant cysteine protease Ervatamin C
Class: hydrolase
Keywords: Plant cysteine protease, two domain, stable at pH 2-12, HYDROLASE
Deposited on 2003-02-21, released 2004-03-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.177
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ervatamin C
    Species: Tabernaemontana divaricata [TaxId:52861]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1o0ea_
  • Chain 'B':
    Compound: Ervatamin C
    Species: Tabernaemontana divaricata [TaxId:52861]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1o0eb_
  • Heterogens: THJ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1o0eA (A:)
    lpeqidwrkkgavtpvknqgscgscwafstvstvesinqirtgnlislseqelvdcdkkn
    hgclggafvfayqyiinnggidtqanypykavqgpcqaaskvvsidgyngvpfcnexalk
    qavavqpstvaidassaqfqqyssgifsgpcgtklnhgvtivgyqanywivrnswgrywg
    ekgyirmlrvggcglcgiarlpyyptka
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1o0eB (B:)
    lpeqidwrkkgavtpvknqgscgscwafstvstvesinqirtgnlislseqelvdcdkkn
    hgclggafvfayqyiinnggidtqanypykavqgpcqaaskvvsidgyngvpfcnexalk
    qavavqpstvaidassaqfqqyssgifsgpcgtklnhgvtivgyqanywivrnswgrywg
    ekgyirmlrvggcglcgiarlpyyptka