PDB entry 1o0b

View 1o0b on RCSB PDB site
Description: crystal structure of l-glutamine and ampcpp bound to glutamine aminoacyl trna synthetase
Deposited on 2003-02-20, released 2003-04-15
The last revision prior to the SCOP 1.69 freeze date was dated 2003-09-09, with a file datestamp of 2003-09-09.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.216
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1o0bA (A:)
    mseaearptnfirqiidedlasgkhttvhtrfppepngylhighaksiclnfgiaqdykg
    qcnlrfddtnpvkedieyvesikndvewlgfhwsgnvryssdyfdqlhayaielinkgla
    yvdeltpeqireyrgtltqpgknspyrdrsveenlalfekmraggfeegkaclrakidma
    spfivmrdpvlyrikfaehhqtgnkwciypmydfthcisdalegithslctlefqdnrrl
    ydwvldnitipvhprqyefsrlnleytvmskrklnllvtdkhvegwddprmptisglrrr
    gytaasirefckrigvtkqdntiemaslesciredlnenapramavidpvklvienyqge
    gemvtmpnhpnkpemgsrqvpfsgeiwidradfreeankqykrlvlgkevrlrnayvika
    ervekdaegnittifctydadtlskdpadgrkvkgvihwvsaahalpveirlydrlfsvp
    npgaaddflsvinpeslvikqgfaepslkdavagkafqferegyfcldsrhstaekpvfn
    rtvglrdtwakvge
    

    Sequence, based on observed residues (ATOM records): (download)
    >1o0bA (A:)
    tnfirqiidedlasgkhttvhtrfppepngylhighaksiclnfgiaqdykgqcnlrfdd
    tnpvkedieyvesikndvewlgfhwsgnvryssdyfdqlhayaielinkglayvdeltpe
    qireyrgtltqpgknspyrdrsveenlalfekmraggfeegkaclrakidmaspfivmrd
    pvlyrikfaehhqtgnkwciypmydfthcisdalegithslctlefqdnrrlydwvldni
    tipvhprqyefsrlnleytvmskrklnllvtdkhvegwddprmptisglrrrgytaasir
    efckrigvtkqdntiemaslesciredlnenapramavidpvklvienyqgegemvtmpn
    hpnkpemgsrqvpfsgeiwidradfreeankqykrlvlgkevrlrnayvikaervekdae
    gnittifctydadtlgvihwvsaahalpveirlydrlfsvpnpgaaddflsvinpeslvi
    kqgfaepslkdavagkafqferegyfcldsrhstaekpvfnrtvglrdt