PDB entry 1nzy

View 1nzy on RCSB PDB site
Description: 4-chlorobenzoyl coenzyme a dehalogenase from pseudomonas sp. strain cbs-3
Deposited on 1996-04-02, released 1997-07-07
The last revision prior to the SCOP 1.55 freeze date was dated 1997-07-07, with a file datestamp of 1997-07-08.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.188
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1nzya_
  • Chain 'B':
    Domains in SCOP 1.55: d1nzyb_
  • Chain 'C':
    Domains in SCOP 1.55: d1nzyc_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nzyA (A:)
    myeaighrvedgvaeitiklprhrnalsvkamqevtdalnraeeddsvgavmitgaedaf
    cagfylreipldkgvagvrdhfriaalwwhqmihkiirvkrpvlaaingvaaggglgisl
    asdmaicadsakfvcawhtigigndtatsyslarivgmrramelmltnrtlypeeakdwg
    lvsrvypkdefrevawkvarelaaapthlqvmakerfhagwmqpveectefeiqnviasv
    thphfmpcltrfldghradrpqvelpagv
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nzyB (B:)
    myeaighrvedgvaeitiklprhrnalsvkamqevtdalnraeeddsvgavmitgaedaf
    cagfylreipldkgvagvrdhfriaalwwhqmihkiirvkrpvlaaingvaaggglgisl
    asdmaicadsakfvcawhtigigndtatsyslarivgmrramelmltdrtlypeeakdwg
    lvsrvypkdefrevawkvarelaaapthlqvmakerfhagwmqpveectefeiqnviasv
    thphfmpcltrfldghradrpqvelpagv
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1nzyC (C:)
    myeaighrvedgvaeitiklprhrnalsvkamqevtdalnraeeddsvgavmitgaedaf
    cagfylreipldkgvagvrdhfriaalwwhqmihkiirvkrpvlaaingvaaggglgisl
    asdmaicadsakfvcawhtigigndtatsyslarivgmrramelmltnrtlypeeakdwg
    lvsrvypkdefrevawkvarelaaapthlqvmakerfhagwmqpveectefeiqnviasv
    thphfmpcltrfldghradrpqvelpagv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nzyC (C:)
    myeaighrvedgvaeitiklprhrnalsvkamqevtdalnraeeddsvgavmitgaedaf
    cagfylreipldkgvagvrdhfriaalwwhqmihkiirvkrpvlaaingvaaggglgisl
    asdmaicadsakfvcawhtigigndtatsyslarivgmrramelmltnrtlypeeakdwg
    lvsrvypkdefrevawkvarelaaapthlqvmakerfhagwmqpveectefeiqnviasv
    thphfmpcltrfldghadrpqvelpagv