PDB entry 1nzt

View 1nzt on RCSB PDB site
Description: Solution Structure of the LpxC Deacetylase of Lipid A Biosynthesis from Aquifex aeolicus with a Bound Substrate-Analog Inhibitor, TU-514
Class: hydrolase
Keywords: LpxC, TU-514, lipid A biosynthesis, lipid A, endotoxin, endotoxin biosynthesis, deacetylase, metalloamidase, zinc, UDP-3-O-acyl-GlcNAc deacetylase, UDP-3-O-(R-3-hydroxymyristoyl)-N-acetylglucosamine deacetylase
Deposited on 2003-02-19, released 2003-06-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2004-11-23, with a file datestamp of 2007-04-25.
Experiment type: NMR15
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase
    Species: Aquifex aeolicus
    Gene: lpxc
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1nzta3, d1nzta4
  • Heterogens: ZN, TUX

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nztA (A:)
    mglektvkeklsfegvgihtgeyskliihpekegtgirffkngvyiparhefvvhtnhst
    dlgfkgqriktvehilsvlhlleitnvtievigneipildgsgwefyeairknilnqnre
    idyfvveepiivedegrlikaepsdtlevtyegefknflgrqkftfvegneeeivlartf
    cfdweiehikkvglgkggslkntlvlgkdkvynpeglryenepvrhkvfdligdlyllgs
    pvkgkfysfrgghslnvklvkelakkqkltrdlphlpsvqal