PDB entry 1nzr

View 1nzr on RCSB PDB site
Description: crystal structure of the azurin mutant nickel-trp48met from pseudomonas aeruginosa at 2.2 angstroms resolution
Deposited on 1994-12-09, released 1995-02-27
The last revision prior to the SCOP 1.55 freeze date was dated 1995-02-27, with a file datestamp of 1995-02-28.
Experiment type: -
Resolution: 2.2 Å
R-factor: 0.17
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1nzra_
  • Chain 'B':
    Domains in SCOP 1.55: d1nzrb_
  • Chain 'C':
    Domains in SCOP 1.55: d1nzrc_
  • Chain 'D':
    Domains in SCOP 1.55: d1nzrd_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nzrA (A:)
    aecsvdiqgndqmqfntnaitvdksckqftvnlshpgnlpknvmghnmvlstaadmqgvv
    tdgmasgldkdylkpddsrviahtkligsgekdsvtfdvsklkegeqymffctfpghsal
    mkgtltlk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nzrB (B:)
    aecsvdiqgndqmqfntnaitvdksckqftvnlshpgnlpknvmghnmvlstaadmqgvv
    tdgmasgldkdylkpddsrviahtkligsgekdsvtfdvsklkegeqymffctfpghsal
    mkgtltlk
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nzrC (C:)
    aecsvdiqgndqmqfntnaitvdksckqftvnlshpgnlpknvmghnmvlstaadmqgvv
    tdgmasgldkdylkpddsrviahtkligsgekdsvtfdvsklkegeqymffctfpghsal
    mkgtltlk
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nzrD (D:)
    aecsvdiqgndqmqfntnaitvdksckqftvnlshpgnlpknvmghnmvlstaadmqgvv
    tdgmasgldkdylkpddsrviahtkligsgekdsvtfdvsklkegeqymffctfpghsal
    mkgtltlk