PDB entry 1nzr

View 1nzr on RCSB PDB site
Description: crystal structure of the azurin mutant nickel-trp48met from pseudomonas aeruginosa at 2.2 angstroms resolution
Class: electron transport (copper)
Keywords: electron transport (copper)
Deposited on 1994-12-09, released 1995-02-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-07-16, with a file datestamp of 2014-07-11.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.17
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Azurin
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00282 (0-127)
      • engineered mutation (47)
    Domains in SCOPe 2.07: d1nzra_
  • Chain 'B':
    Compound: Azurin
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00282 (0-127)
      • engineered mutation (47)
    Domains in SCOPe 2.07: d1nzrb_
  • Chain 'C':
    Compound: Azurin
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00282 (0-127)
      • engineered mutation (47)
    Domains in SCOPe 2.07: d1nzrc_
  • Chain 'D':
    Compound: Azurin
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00282 (0-127)
      • engineered mutation (47)
    Domains in SCOPe 2.07: d1nzrd_
  • Heterogens: NI, NO3, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nzrA (A:)
    aecsvdiqgndqmqfntnaitvdksckqftvnlshpgnlpknvmghnmvlstaadmqgvv
    tdgmasgldkdylkpddsrviahtkligsgekdsvtfdvsklkegeqymffctfpghsal
    mkgtltlk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nzrB (B:)
    aecsvdiqgndqmqfntnaitvdksckqftvnlshpgnlpknvmghnmvlstaadmqgvv
    tdgmasgldkdylkpddsrviahtkligsgekdsvtfdvsklkegeqymffctfpghsal
    mkgtltlk
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nzrC (C:)
    aecsvdiqgndqmqfntnaitvdksckqftvnlshpgnlpknvmghnmvlstaadmqgvv
    tdgmasgldkdylkpddsrviahtkligsgekdsvtfdvsklkegeqymffctfpghsal
    mkgtltlk
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nzrD (D:)
    aecsvdiqgndqmqfntnaitvdksckqftvnlshpgnlpknvmghnmvlstaadmqgvv
    tdgmasgldkdylkpddsrviahtkligsgekdsvtfdvsklkegeqymffctfpghsal
    mkgtltlk