PDB entry 1nzk

View 1nzk on RCSB PDB site
Description: Crystal Structure of a Multiple Mutant (L44F, L73V, V109L, L111I, C117V) of Human Acidic Fibroblast Growth Factor
Class: hormone/growth factor
Keywords: beta-trefoil, HORMONE/GROWTH FACTOR COMPLEX
Deposited on 2003-02-18, released 2004-03-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.196
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: acidic fibroblast growth factor
    Species: Homo sapiens [TaxId:9606]
    Gene: FGF1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05230 (Start-142)
      • engineered (49)
      • engineered (78)
      • engineered (114)
      • engineered (116)
      • engineered (122)
    Domains in SCOPe 2.07: d1nzka_
  • Chain 'B':
    Compound: acidic fibroblast growth factor
    Species: Homo sapiens [TaxId:9606]
    Gene: FGF1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05230 (Start-142)
      • engineered (49)
      • engineered (78)
      • engineered (114)
      • engineered (116)
      • engineered (122)
    Domains in SCOPe 2.07: d1nzkb_
  • Chain 'C':
    Compound: acidic fibroblast growth factor
    Species: Homo sapiens [TaxId:9606]
    Gene: FGF1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05230 (Start-142)
      • engineered (49)
      • engineered (78)
      • engineered (114)
      • engineered (116)
      • engineered (122)
    Domains in SCOPe 2.07: d1nzkc_
  • Chain 'D':
    Compound: acidic fibroblast growth factor
    Species: Homo sapiens [TaxId:9606]
    Gene: FGF1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05230 (Start-142)
      • engineered (49)
      • engineered (78)
      • engineered (114)
      • engineered (116)
      • engineered (122)
    Domains in SCOPe 2.07: d1nzkd_
  • Heterogens: SO4, FMT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1nzkA (A:)
    hhhhhhfnlppgnykkpkllycsngghflrilpdgtvdgtrdrsdqhiqfqlsaesvgev
    yikstetgqylamdtdglvygsqtpneeclflerleenhyntyiskkhaeknwflgikkn
    gsvkrgprthygqkailflplpv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nzkA (A:)
    hhhhfnlppgnykkpkllycsngghflrilpdgtvdgtrdrsdqhiqfqlsaesvgevyi
    kstetgqylamdtdglvygsqtpneeclflerleenhyntyiskkhaeknwflgikkngs
    vkrgprthygqkailflplpv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1nzkB (B:)
    hhhhhhfnlppgnykkpkllycsngghflrilpdgtvdgtrdrsdqhiqfqlsaesvgev
    yikstetgqylamdtdglvygsqtpneeclflerleenhyntyiskkhaeknwflgikkn
    gsvkrgprthygqkailflplpv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nzkB (B:)
    hhhhfnlppgnykkpkllycsngghflrilpdgtvdgtrdrsdqhiqfqlsaesvgevyi
    kstetgqylamdtdglvygsqtpneeclflerleenhyntyiskkhaeknwflgikkngs
    vkrgprthygqkailflplpv
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1nzkC (C:)
    hhhhhhfnlppgnykkpkllycsngghflrilpdgtvdgtrdrsdqhiqfqlsaesvgev
    yikstetgqylamdtdglvygsqtpneeclflerleenhyntyiskkhaeknwflgikkn
    gsvkrgprthygqkailflplpv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nzkC (C:)
    hhhhfnlppgnykkpkllycsngghflrilpdgtvdgtrdrsdqhiqfqlsaesvgevyi
    kstetgqylamdtdglvygsqtpneeclflerleenhyntyiskkhaeknwflgikkngs
    vkrgprthygqkailflplpv
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1nzkD (D:)
    hhhhhhfnlppgnykkpkllycsngghflrilpdgtvdgtrdrsdqhiqfqlsaesvgev
    yikstetgqylamdtdglvygsqtpneeclflerleenhyntyiskkhaeknwflgikkn
    gsvkrgprthygqkailflplpv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nzkD (D:)
    hhhhfnlppgnykkpkllycsngghflrilpdgtvdgtrdrsdqhiqfqlsaesvgevyi
    kstetgqylamdtdglvygsqtpneeclflerleenhyntyiskkhaeknwflgikkngs
    vkrgprthygqkailflplpv