PDB entry 1nzj

View 1nzj on RCSB PDB site
Description: Crystal Structure and Activity Studies of Escherichia Coli Yadb ORF
Class: structural genomics, unknown function
Keywords: zn cluster, glutamyl t-RNA synthetase, structural genomics, unknown function
Deposited on 2003-02-18, released 2004-04-13
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hypothetical protein yadB
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1nzja_
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1nzjA (A:)
    mtdtqyigrfapspsgelhfgsliaalgsylqararqgrwlvriedidpprevpgaaeti
    lrqlehyglhwdgdvlwqsqrhdayrealawlheqglsyyctctrariqsiggiydghcr
    vlhhgpdnaavrirqqhpvtqftdqlrgiihadeklaredfiihrrdglfaynlavvvdd
    hfqgvteivrgadlieptvrqislyqlfgwkvpdyihlplalnpqgaklskqnhapalpk
    gdprpvliaalqflgqqaeahwqdfsveqilqsavknwrltavpesaivnstfsnasc
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nzjA (A:)
    tqyigrfapspsgelhfgsliaalgsylqararqgrwlvriedidpprevpgaaetilrq
    lehyglhwdgdvlwqsqrhdayrealawlheqglsyyctctrariqsiggiydghcrvlh
    hgpdnaavrirqqhpvtqftdqlrgiihadeklaredfiihrrdglfaynlavvvddhfq
    gvteivrgadlieptvrqislyqlfgwkvpdyihlplalnalpkgdprpvliaalqflgq
    qaeahwqdfsveqilqsavknwrltavpesaiv