PDB entry 1nzi

View 1nzi on RCSB PDB site
Description: Crystal Structure of the CUB1-EGF Interaction Domain of Complement Protease C1s
Deposited on 2003-02-18, released 2003-06-10
The last revision prior to the SCOP 1.69 freeze date was dated 2003-09-09, with a file datestamp of 2003-09-09.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.216
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1nziA (A:)
    eptmygeilspnypqaypsevekswdievpegygihlyfthldielsencaydsvqiisg
    dteegrlcgqrssnnphspiveefqvpynklqvifksdfsneerftgfaayyvatdinec
    tdfvdvpcshfcnnfiggyfcscppeyflhddmkncgvn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nziA (A:)
    eptmygeilspnypqaypsevekswdievpegygihlyfthldielsencaydsvqiise
    egrlcgqrssnnphspiveefqvpynklqvifksdfsneerftgfaayyvatdinectdv
    dvpcshfcnnfiggyfcscppeyflhddmkncgvn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1nziB (B:)
    eptmygeilspnypqaypsevekswdievpegygihlyfthldielsencaydsvqiisg
    dteegrlcgqrssnnphspiveefqvpynklqvifksdfsneerftgfaayyvatdinec
    tdfvdvpcshfcnnfiggyfcscppeyflhddmkncgvn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nziB (B:)
    tmygeilspnypqaypsevekswdievpegygihlyfthldielsencaydsvqiisgdt
    eegrlcgqrssnphspiveefqvpynklqvifksdfsneerftgfaayyvatdinectdf
    vdvpcshfcnnfiggyfcscppeyflhddmkncgvn