PDB entry 1nzh

View 1nzh on RCSB PDB site
Description: Crystal Structure of Cimex Nitrophorin NO Complex
Class: transport protein
Keywords: heme protein, beta-sandwich, NO carrier, ferrous NO complex, N-nitrosocysteine
Deposited on 2003-02-17, released 2004-03-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2004-11-30, with a file datestamp of 2007-04-25.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.17
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Salivary nitrophorin
    Species: Cimex lectularius
    Database cross-references and differences (RAF-indexed):
    • GB AAC28738 (Start-281)
    Domains in SCOPe 2.07: d1nzha_
  • Heterogens: NMO, HEM, TRS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1nzhA (A:)
    gsppaqlsvhtvswnsgheraptnleellglnsgetpdviavavqgfgfqtdkpqqgpac
    vknfqslltskgytklkntitetmgltvyclekhldqntlknetiivtvddqkksggivt
    sftiynkrfsfttsrmsdedvtstntkyaydtrldyskkddpsdflfwigdlnvrvetna
    thakslvdqnnidglmafdqlkkakeqklfdgwtepqvtfkptykfkpntdeydlsatps
    wtdralyksgtgktiqplsynsltnykqtehrpvlakfrvtl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nzhA (A:)
    ppaqlsvhtvswnsgheraptnleellglnsgetpdviavavqgfgfqtdkpqqgpacvk
    nfqslltskgytklkntitetmgltvyclekhldqntlknetiivtvddqkksggivtsf
    tiynkrfsfttsrmsdedvtstntkyaydtrldyskkddpsdflfwigdlnvrvetnath
    akslvdqnnidglmafdqlkkakeqklfdgwtepqvtfkptykfkpntdeydlsatpswt
    dralyksgtgktiqplsynsltnykqtehrpvlakfrvtl