PDB entry 1nze

View 1nze on RCSB PDB site
Description: Crystal structure of PsbQ polypeptide of photosystem II from higher plants
Deposited on 2003-02-17, released 2003-08-26
The last revision prior to the SCOP 1.67 freeze date was dated 2003-12-23, with a file datestamp of 2003-12-23.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.227
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1nzea_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1nzeA (A:)
    earpivvgpppplsgglpgtensdqardgtlpytkdrfylqplppteaaqrakvsaseil
    nvkqfidrkawpslqndlrlrasylrydlktvisakpkdekkslqeltsklfssidnldh
    aakikspteaekyygqtvsninevlaklg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nzeA (A:)
    fylqplppteaaqrakvsaseilnvkqfidrkawpslqndlrlrasylrydlktvisakp
    kdekkslqeltsklfssidnldhaakikspteaekyygqtvsninevlaklg