PDB entry 1nze

View 1nze on RCSB PDB site
Description: Crystal structure of PsbQ polypeptide of photosystem II from higher plants
Class: oxidoreductase
Keywords: Photosystem II, oxygen-enhancer evolving complex, water oxidizing complex, PsbQ, OEE3, OXIDOREDUCTASE
Deposited on 2003-02-17, released 2003-08-26
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.227
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Oxygen-evolving enhancer protein 3
    Species: Spinacia oleracea [TaxId:3562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1nzea_
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1nzeA (A:)
    earpivvgpppplsgglpgtensdqardgtlpytkdrfylqplppteaaqrakvsaseil
    nvkqfidrkawpslqndlrlrasylrydlktvisakpkdekkslqeltsklfssidnldh
    aakikspteaekyygqtvsninevlaklg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nzeA (A:)
    fylqplppteaaqrakvsaseilnvkqfidrkawpslqndlrlrasylrydlktvisakp
    kdekkslqeltsklfssidnldhaakikspteaekyygqtvsninevlaklg